KEGG   Meriones unguiculatus (Mongolian gerbil): 110563636
Entry
110563636         CDS       T05884                                 

Gene name
Irak4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04722  Neurotrophin signaling pathway
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110563636 (Irak4)
   04064 NF-kappa B signaling pathway
    110563636 (Irak4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110563636 (Irak4)
   04621 NOD-like receptor signaling pathway
    110563636 (Irak4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110563636 (Irak4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110563636 (Irak4)
   05135 Yersinia infection
    110563636 (Irak4)
   05133 Pertussis
    110563636 (Irak4)
   05152 Tuberculosis
    110563636 (Irak4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110563636 (Irak4)
   05161 Hepatitis B
    110563636 (Irak4)
   05171 Coronavirus disease - COVID-19
    110563636 (Irak4)
   05164 Influenza A
    110563636 (Irak4)
   05162 Measles
    110563636 (Irak4)
   05168 Herpes simplex virus 1 infection
    110563636 (Irak4)
   05169 Epstein-Barr virus infection
    110563636 (Irak4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110563636 (Irak4)
   05140 Leishmaniasis
    110563636 (Irak4)
   05142 Chagas disease
    110563636 (Irak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110563636 (Irak4)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110563636 (Irak4)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110563636 (Irak4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Death
Other DBs
NCBI-GeneID: 110563636
NCBI-ProteinID: XP_021516475
LinkDB
Position
Unknown
AA seq 457 aa
MNKPLTPSTYVRSLNVGIIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QSGKSPTCELLFDWGTTNCTVGDLVDLLVQTEFFAPATLLLPDAVPQTISNIPTGEAVTV
AQTHGPCCGKDRTSVMPKQEQSCVPPDSSRPDSKSSEFSDTRFHSFSFYELKSITNNFDE
RPVSVGGNRMGEGGFGVVYKGCVDNTPVAVKKLGAMVEISTEELKQQFDQEIKVMAKCQH
ENLVELLGFSSDSTDLCLVYAYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIRFL
HENHHIHRDIKSANILLDKDFTAKISDFGLARASAKFAQTVMTSRIVGTTAYMAPEALRG
EITPKSDIYSFGVVLLELITGLAAVDENRDPQLLLDIKDEIEDEEKTIEDYTDKKMNDVD
PASVEAMYSTASQCLQEKKNKRPDITKVQQLLQETSP
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaacaagcctctgacaccatcaacatacgtgcgcagcctcaatgtcgggatcattagg
aagctctcggatttcattgatcctcaagaaggatggaagaaactagcggtagctattaaa
aagccatccggtgatgataggtacaatcagtttcatataaggaggttcgaagccttgctt
caaagcgggaagagccccacctgtgagctgctgtttgactggggcaccacgaactgcacg
gtcggtgaccttgtggatcttctggtccagaccgagttttttgcccctgctacgctcctg
ctgccggatgccgttccccagaccatcagcaacatacctaccggagaagcggtaacagtg
gcacagacacatgggccttgctgtgggaaggacaggacatccgtgatgccaaagcaagag
caaagctgtgtgccacccgactcctcacgtccagacagtaaaagctcagaattcagcgat
actcgttttcatagtttctcattttatgagctgaagagtatcacaaataactttgacgag
cgacccgtgtctgtcggtggcaacagaatgggggagggggggttcggagtggtgtacaag
ggctgcgtggacaacacacctgtggcagtgaagaagctcggagcaatggttgaaatcagc
actgaagaattgaaacaacagtttgatcaagaaattaaagtaatggcaaagtgtcagcac
gagaacctcgtggagctccttggcttctccagcgacagcaccgacctgtgtttggtgtat
gcctacatgcccaacggctccttgctagacagactgtcctgcctggatggtactccaccg
ctttcttggcacatgagatgcaagattgctcagggtgcagccaatggcatcaggttttta
catgaaaatcatcacattcatagagatattaaaagtgcaaatatcttactagacaaagac
tttactgccaaaatatctgactttgggcttgcacgggcttcggcgaaatttgcacagacc
gtcatgaccagccgaatcgtgggcacaacagcttacatggcacccgaagctttgcgagga
gaaataacgcccaaatctgacatctacagctttggtgtggttctgttagagctaataacc
ggacttgcggccgtggatgaaaaccgtgaccctcagttgctactggatattaaagatgaa
attgaagatgaagaaaagacgattgaagactacacggacaagaagatgaacgatgtggac
cctgcttccgtcgaggccatgtactccactgctagtcagtgtctgcaggaaaagaaaaat
aagaggccggacattaccaaggttcagcaactgctccaagaaacgtctccttaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110566945
Entry
110566945         CDS       T05884                                 

Gene name
Irak1
Definition
(RefSeq) interleukin-1 receptor-associated kinase 1 isoform X1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04620  Toll-like receptor signaling pathway
mun04722  Neurotrophin signaling pathway
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110566945 (Irak1)
   04064 NF-kappa B signaling pathway
    110566945 (Irak1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110566945 (Irak1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110566945 (Irak1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110566945 (Irak1)
   05135 Yersinia infection
    110566945 (Irak1)
   05133 Pertussis
    110566945 (Irak1)
   05152 Tuberculosis
    110566945 (Irak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110566945 (Irak1)
   05161 Hepatitis B
    110566945 (Irak1)
   05171 Coronavirus disease - COVID-19
    110566945 (Irak1)
   05162 Measles
    110566945 (Irak1)
   05168 Herpes simplex virus 1 infection
    110566945 (Irak1)
   05169 Epstein-Barr virus infection
    110566945 (Irak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110566945 (Irak1)
   05140 Leishmaniasis
    110566945 (Irak1)
   05142 Chagas disease
    110566945 (Irak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110566945 (Irak1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110566945 (Irak1)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110566945 (Irak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death RAMP APH Seadorna_VP7
Other DBs
NCBI-GeneID: 110566945
NCBI-ProteinID: XP_021520540
LinkDB
Position
Unknown
AA seq 704 aa
MAGGLGPGEPAVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPVLPPSTAAPRPTS
ISPGSEAEDWSPRKLQSSASTFLSPAFPGSKTHSKSELPIPSPASFGPPLQSSALSSTKQ
PSPESPVSELQKVHPSPFCWPLCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKR
LKEEADLEWTVVKQSFLTEVEQLSRFHHPNIVDFAGYCAESGFYCLVYGFLPNGSLEDRL
HLQTCSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFGLA
RFSRLAGANPSQSSSVARTCTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAGQR
AVRTQGTRTKYLKDLIEDEAEEAGVALKSTQPTLQLGMAMDAWAAPIAAHIYKKHLDYRP
GPCPPRLGLALAQLACCCMHRRAKKRPPMTQVYKSLEGLQAGPPWEPEVAGHGPPSPQEN
SYMSTTGSAQSGGEPWQHVVVSRRSPAQLQKTPNQPVESDESVPCLSAALHSWHLTPGSC
PSPPSFREASCTQEGTTRESCWRSDPGVQPTTVEGSSMGSSTSLPSEPPQIIINPARQKM
IQKLALYEEGVLDSLQLLSSGFFPGLDLEHENRQGPEESDEFQS
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggccgggggtctgggccccggggagcctgcagttccgggcgcccagcacttcttgtac
gaggtgccaccctgggttatgtgccgtttctacaaagtgatggacgccttggagcccgcc
gactggtgccagtttgcggccttgatcgtgcgcgatcagacagagctgcggctgtgcgag
cgctcagagcagcgcacggccagcgtcctgtggccctggatcaaccgcaacgcacgagtg
gctgacctcgttcacatcctcacgcacctgcagctgctgcgagcgcgggacatcattaca
gcctggcacccccctgccccagttctgcccccaagcaccgctgctccaaggcccacgagc
atctctccaggctccgaggctgaggactggagtccccggaaattacagtcctctgcctcc
accttcctctccccagcttttccaggctccaagacccattccaaatcagagctccccatt
ccaagccctgcttccttcgggccaccactgcaatcttcagccctttcctctaccaagcag
ccaagcccagagagcccagtgtctgagctccaaaaagtccatccctccccattttgctgg
cccctctgtgagatttcccaaggcacctgcaacttctctgaagagctcaggattggagag
ggtggttttgggtgtgtgtaccgagcagtaatgagaaataccacatatgctgtgaagaga
ctgaaggaggaggctgatctagagtggactgtggtgaaacagagcttcttaactgaggtg
gaacagctgtcaaggtttcatcacccaaatatagtggactttgctggctactgtgcagag
agtggcttctactgccttgtttatggcttcctgcccaatgggtccttggaggatcgactg
caccttcagacctgctccccactctcttggcctcaacgactggacattcttctgggcaca
gcccgggctattcagtttttacatcaggacagccccagcctcatccatggagacatcaag
agttctaatgtgcttctggatgagaggctgatgcccaagctgggagactttggcctggct
cgtttcagccgccttgcaggggccaacccaagccagagcagttctgtggcccggacttgc
acagtacggggtacccttgcctacctgcctgaggagtacatcaagacaggtcggttagct
gtggacaccgataccttcagctttggagtggtgatattggaaacccttgctggtcagagg
gctgtgaggacacaaggtaccaggaccaagtatctgaaagacctgattgaagatgaggct
gaagaggccggagtggccctgaaaagcacccagcctactctgcagttgggtatggccatg
gatgcttgggctgctccaattgctgcccacatctataagaagcacctggactacagacct
gggccctgcccaccccgattgggcctggccctagctcaactggcttgttgctgcatgcac
cgtcgggccaagaagaggccccccatgacccaggtatacaagagtctagaggggctgcag
gcagggcctccttgggagccagaggttgccggccatggccccccttccccacaggagaac
tcctacatgtctaccactggcagtgcccagagtgggggtgaaccatggcagcatgtagta
gtgagcagaagatccccagcccagctccagaaaactcccaaccagccagtggagagtgat
gagagtgttccctgcctctctgctgccctgcactcctggcacttgactccaggttcctgc
ccaagcccaccatccttcagagaggctagctgtacccaagagggcactaccagagaatca
tgttggaggagtgatccaggtgttcagcccacaaccgtggaaggctcatccatgggcagc
tccacatcgctgccatcagagccaccacagatcatcatcaacccagcccgacagaagatg
atacagaagctggccctatatgaggagggggtcttggatagcctgcaactgctgtcatca
ggctttttcccaggcttggatttagaacatgaaaacaggcaggggcctgaagaaagtgac
gaatttcagagctga

DBGET integrated database retrieval system