KEGG   Meriones unguiculatus (Mongolian gerbil): 110563686
Entry
110563686         CDS       T05884                                 

Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00590  Arachidonic acid metabolism
mun01100  Metabolic pathways
mun04664  Fc epsilon RI signaling pathway
mun04726  Serotonergic synapse
mun04913  Ovarian steroidogenesis
mun05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110563686
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    110563686
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110563686
  09156 Nervous system
   04726 Serotonergic synapse
    110563686
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110563686
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     110563686
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 110563686
NCBI-ProteinID: XP_021516529
LinkDB
Position
Unknown
AA seq 674 aa
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDE
ELGEIHLIKIEKRKYWLHDDWYLKYITLKTPHGDYIEFPCYRWITGEGEIVLRDGRAKLA
RDDQIHILKQHRRKELEGRQKQYRWMEWNPGFPLSIDAKCHRDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNG
CNPALIKRCTQLPEKLPVTTEMVECSLERQLTLEQEVQEGNIFIVDYELLDGIDANKTDP
CTHQFLAAPICLLYKNLANKIVPIAIQLSQAPGEKNPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYG
LFDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDIPYYFYRDDGLLVWK
AIQEFTTEVVSIYYENDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPY
YYLSPDRIPNSVAI
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccctcctacacggtcactgtggccaccggcagccagtggttcgcgggcacggacgac
tacatctacctcagcctggttggctccgcgggctgcagcgagaagcacctgctggacaag
gccttctacaacgacttcgagcgtggtgcggtggactcctacgacgtcactgtggatgaa
gaactgggtgagatccatctgatcaaaatcgagaagcgcaaatactggctccatgatgac
tggtacctgaagtacatcaccctgaagacgccccacggggactacatcgagttcccgtgc
taccgctggatcacgggcgagggcgagattgtcctgcgggatgggcgtgcaaaactggcc
cgagacgaccaaattcacattctcaagcagcaccggcgtaaagaactggaaggacgccaa
aagcagtaccgatggatggagtggaaccctggcttccctttgagtattgatgccaaatgc
cacagggatttaccccgagacatccagtttgatagtgaaaaaggcgtggactttgttctg
aactactcaaaagcgatggagaacctgttcatcaatcgcttcatgcacatgttccagtct
tcctggaacgacttcgctgacttcgagaaaatctttgtcaagatcagcaacaccatttct
gagcgagtcaagaaccactggcaggaggacctcatgtttggctaccagttcctgaatggc
tgcaacccagcgctcatcaagcgttgcacccagctgccggagaagctcccggtgactaca
gagatggtggagtgtagcctagagcggcagctcaccttagaacaggaagtacaggaaggg
aacattttcattgttgactacgagctactggatggcatcgatgccaacaaaactgacccc
tgcacacaccagttcctggctgcgcccatctgcctgctatataagaacctggccaacaag
attgttcccattgccatccagctcagtcaagcccctggagagaagaacccaattttcctc
ccttccgatgcaaaatacgactggcttttggccaaaatctgggtgcgctccagtgacttc
cacgtccatcagaccatcacccaccttctgcgcacacacctggtgtctgaggtgttcggc
atcgccatgtaccgccagctgccagccgtgcaccccctcttcaagctgctggtagcccat
gtgagattcaccatcgccatcaacactaaggcccgggaacagcttatctgcgagtatggc
ctttttgacaaggccaatgccaccgggggtggcggccatgtgcagatggtgcagagggct
gtccaggacctgacctattcttccttgtgcttcccggaggccatcaaggcccggggcatg
gacagcactgaggacatcccgtactacttctatcgtgacgatggactgctagtgtggaag
gccatccaggagttcacgaccgaggtggtgagcatctactatgagaatgaccaggtggtg
gaggaggaccaggaactgcaggacttcgtgaaggatgtttacgtgtatggcatgaggggc
agaaaggcctcaggcttccccaagtccatcaagagcagggagaagttgtctgaatacctg
acggtagtgatcttcacggcctcggcccagcatgcggctgtaaacttcggacagtatgac
tggtgctcctggattcccaatgctcctccaaccatgcgagccccaccacccacggccaag
ggcgtggtcaccatcgagcagattgtggatacgctaccagaccgaggccgttcatgctgg
catctaggcgcagtgtgggcacttagccagtttcaagaaaatgagctgtttctgggcatg
tacccagaggaacatttcattgagaaaccagtgaaggaagccatgatccgattccgcaag
aacctggaggccatcgtcagtgtgattgccgagcgcaacaagaacaaaaagctcccctac
tactacctgtcaccagacaggattcccaacagcgtagcgatctaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110563694
Entry
110563694         CDS       T05884                                 

Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00590  Arachidonic acid metabolism
mun01100  Metabolic pathways
mun04664  Fc epsilon RI signaling pathway
mun04726  Serotonergic synapse
mun04913  Ovarian steroidogenesis
mun05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110563694
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    110563694
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110563694
  09156 Nervous system
   04726 Serotonergic synapse
    110563694
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110563694
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     110563694
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 110563694
NCBI-ProteinID: XP_021516539
LinkDB
Position
Unknown
AA seq 674 aa
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDE
ELGEIHLIKIEKRKYWLHDDWYLKYITLKTPHGDYIEFPCYRWITGEGEIVLRDGRAKLA
RDDQIHILKQHRRKELEGRQKQYRWMEWNPGFPLSIDAKCHRDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNG
CNPALIKRCTQLPEKLPVTTEMVECSLERQLTLEQEVQEGNIFIVDYELLDGIDANKTDP
CTHQFLAAPICLLYKNLANKIVPIAIQLSQAPGEKNPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYG
LFDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDIPYYFYRDDGLLVWK
AIQEFTTEVVSIYYENDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPY
YYLSPDRIPNSVAI
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccctcctacacggtcactgtggccaccggcagccagtggttcgcgggcacggacgac
tacatctacctcagcctggttggctccgcgggctgcagcgagaagcacctgctggacaag
gccttctacaacgacttcgagcgtggtgcggtggactcctacgacgtcactgtggatgaa
gaactgggtgagatccatctgatcaaaatcgagaagcgcaaatactggctccatgatgac
tggtacctgaagtacatcaccctgaagacgccccacggggactacatcgagttcccgtgc
taccgctggatcacgggcgagggcgagattgtcctgcgggatgggcgtgcaaaactggcc
cgagacgaccaaattcacattctcaagcagcaccggcgtaaagaactggaaggacgccaa
aagcagtaccgatggatggagtggaaccctggcttccctttgagtattgatgccaaatgc
cacagggatttaccccgagacatccagtttgatagtgaaaaaggcgtggactttgttctg
aactactcaaaagcgatggagaacctgttcatcaatcgcttcatgcacatgttccagtct
tcctggaacgacttcgctgacttcgagaaaatctttgtcaagatcagcaacaccatttct
gagcgagtcaagaaccactggcaggaggacctcatgtttggctaccagttcctgaatggc
tgcaacccagcgctcatcaagcgttgcacccagctgccggagaagctcccggtgactaca
gagatggtggagtgtagcctagagcggcagctcaccttagaacaggaagtacaggaaggg
aacattttcattgttgactacgagctactggatggcatcgatgccaacaaaactgacccc
tgcacacaccagttcctggctgcgcccatctgcctgctatataagaacctggccaacaag
attgttcccattgccatccagctcagtcaagcccctggagagaagaacccaattttcctc
ccttccgatgcaaaatacgactggcttttggccaaaatctgggtgcgctccagtgacttc
cacgtccatcagaccatcacccaccttctgcgcacacacctggtgtctgaggtgttcggc
atcgccatgtaccgccagctgccagccgtgcaccccctcttcaagctgctggtagcccat
gtgagattcaccatcgccatcaacactaaggcccgggaacagcttatctgcgagtatggc
ctttttgacaaggccaatgccaccgggggtggcggccatgtgcagatggtgcagagggct
gtccaggacctgacctattcttccttgtgcttcccggaggccatcaaggcccggggcatg
gacagcactgaggacatcccgtactacttctatcgtgacgatggactgctagtgtggaag
gccatccaggagttcacgaccgaggtggtgagcatctactatgagaatgaccaggtggtg
gaggaggaccaggaactgcaggacttcgtgaaggatgtttacgtgtatggcatgaggggc
agaaaggcctcaggcttccccaagtccatcaagagcagggagaagttgtctgaatacctg
acggtagtgatcttcacggcctcggcccagcatgcggctgtaaacttcggacagtatgac
tggtgctcctggattcccaatgctcctccaaccatgcgagccccaccacccacggccaag
ggcgtggtcaccatcgagcagattgtggatacgctaccagaccgaggccgttcatgctgg
catctaggcgcagtgtgggcacttagccagtttcaagaaaatgagctgtttctgggcatg
tacccagaggaacatttcattgagaaaccagtgaaggaagccatgatccgattccgcaag
aacctggaggccatcgtcagtgtgattgccgagcgcaacaagaacaaaaagctcccctac
tactacctgtcaccagacaggattcccaacagcgtagcgatctaa

DBGET integrated database retrieval system