KEGG   Meriones unguiculatus (Mongolian gerbil): 110563779Help
Entry
110563779         CDS       T05884                                 

Gene name
Hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00010  Glycolysis / Gluconeogenesis
mun00051  Fructose and mannose metabolism
mun00052  Galactose metabolism
mun00500  Starch and sucrose metabolism
mun00520  Amino sugar and nucleotide sugar metabolism
mun00524  Neomycin, kanamycin and gentamicin biosynthesis
mun01100  Metabolic pathways
mun01200  Carbon metabolism
mun04066  HIF-1 signaling pathway
mun04910  Insulin signaling pathway
mun04930  Type II diabetes mellitus
mun04973  Carbohydrate digestion and absorption
mun05230  Central carbon metabolism in cancer
Module
mun_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mun_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110563779 (Hk1)
   00051 Fructose and mannose metabolism
    110563779 (Hk1)
   00052 Galactose metabolism
    110563779 (Hk1)
   00500 Starch and sucrose metabolism
    110563779 (Hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    110563779 (Hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110563779 (Hk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110563779 (Hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110563779 (Hk1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110563779 (Hk1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    110563779 (Hk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110563779 (Hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110563779 (Hk1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110563779 (Hk1)
Membrane trafficking [BR:mun04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110563779 (Hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110563779
NCBI-ProteinID: XP_021516650
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEVLIDILTRFKKEMKNGLSRDYNPTAS
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVYMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFKASGV
EGSDVVKLLDKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGVQNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKSTPRLRTTVGVDGSLYKSH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLSNFRLS
KETLLEVKRRLRAEMEFGLKKETNPKATVKMLPSFVRSIPDGTENGDFLALDLGGTNFRV
LLVKVRSGKKRTVEMHNKIYSIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCNQTSLDCGILISWTKGFKASDCEGHDVATLLREAVKRRDEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMRNVEMLEGNQGQMCINMEWGAFGDNGCLDD
IRTDFDNIVDEYSLNAGKQKFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRTILQQLGINSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKG
AALITAVGVRLRDAPNA
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctgcgcagctcttggcttattacttcaccgagctgaaggatgaccaagtcaaa
aagattgataagtatctgtatgccatgcggctctctgatgaagttctgattgatatcctg
acacgcttcaagaaagaaatgaagaatggcctttcccgggattataatccaacagcctcg
gtcaagatgttgccaacctttgtgcggtccattcctgatggctcagaaaagggggatttc
attgccctggatctcggaggctcttcctttcgaatcctgcgggtgcaggtgaatcatgag
aagaaccagaatgtctacatggagtctgaggtttatgacactccagagaacatcgttcac
ggcagtggaagccagcttttcgatcatgttgctgaatgcctgggagacttcatggaaaaa
aggaagatcaaggacaagaaattacccgtgggattcacgttttctttcccctgccggcaa
tccaaaatagacgaggctatactgatcacatggacaaagcggttcaaagccagtggtgtg
gaagggtcggatgtggtcaagctgctggataaagccattaagaagcgaggggactacgac
gctaacatcgtcgctgtggtgaatgacacagtggggaccatgatgacctgtggttacgac
gaccagcagtgtgaagttggcctgatcatcggcacgggcaccaacgcgtgctacatggag
gagctgaggcacattgacctggtggaaggtgatgagggccggatgtgcatcaacaccgag
tggggggccttcggggacgacgggtccctggaggacatccgcacagagttcgacagggag
ctggaccgggggtccctcaaccccgggaagcaactgttcgagaagatggtgagcggcatg
tacatgggggagctggtccggctgatcctggtgaagatggccaaggaaggcctcctgttt
gaagggcgcatcactccagaactgctcacgaggggcaagtttaacacgagtgacgtgtcc
gccattgaaaagaataaggagggtgttcagaatgccaaggagatcttaacccgcctggga
gtggagccgtctgacgacgactgtgtgtcggtccagcacgtgtgcaccattgtctccttc
cggtcagccaacctggtggctgccacgctcggtgccatcctgaaccgcctgcgagacaac
aagagcacgcccaggctgcgaaccacagttggtgtggacggctctctctacaagtcacac
ccacagtattcccggcgattccacaagaccctgaggcgcctggtgcccgactccgatgtg
cgtttcctcctttcagagagcggcagtggcaagggggctgccatggtgaccgctgtagcc
taccgcctggctgagcagcacaggcagattgaggagaccctgtccaacttccgcctcagc
aaggagacactgctggaggtgaagaggaggctgcgggctgagatggaatttgggctgaag
aaggagacgaaccctaaggctaccgtcaagatgctgccttccttcgtccggagcatcccg
gacgggactgagaatggtgacttcttggccttggatcttggaggaacgaatttccgagtc
ctactggtaaaggtccgtagtggaaaaaagagaacagtggaaatgcacaacaagatctac
tccattcctatagagatcatgcaaggcactggggaagagttgtttgaccacatcgtctcc
tgcatctccgacttcctggactacatggggatcaaaggcccccggatgcctctgggcttc
accttctcatttccctgcaatcagacgagcctggattgtggaatcttgatctcgtggaca
aagggtttcaaggccagtgactgcgagggacatgatgtagccaccttactgagggaggcg
gtgaaaagaagagatgaatttgacctggatgtggtggctgtggtcaacgacactgtgggt
accatgatgacctgtgcctatgaggaacccacttgtgaggtgggactcatcgtggggacc
ggcagcaacgcctgctacatggaggagatgaggaacgtggagatgctggaggggaaccag
gggcagatgtgcatcaacatggagtggggcgcctttggtgacaacggctgcctggatgac
atcaggacggactttgataacatagtggacgaatactccctaaacgctgggaaacaaaag
tttgagaagatgatcagtgggatgtacctaggtgagatagtccgtaacatcctgatcgac
ttcaccaagaaagggttcctcttccggggacagatctctgagccactcaagactcgaggc
atctttgagaccaagtttctctctcagattgagagtgaccggttagcactgctccaggtg
cggaccatccttcagcagctgggcataaacagtacgtgtgacgacagtatcctggtgaag
accgtgtgtggagtggtgtccaagagggcagcccagctgtgcggcgcgggcatggccgcc
gtggtggagaagattagagagaacagaggcctagaccatctgaatgtgaccgtgggagtg
gatgggacactctacaaacttcatccacacttctccagaatcatgcaccaaactgtgaag
gaactgtcaccaaagtgtaccgtgtccttcctcctgtctgaagatggcagcggcaagggc
gccgccctcatcacagctgtgggcgtgcggctcagagatgctccaaatgcctaa

DBGET integrated database retrieval system