KEGG   Meriones unguiculatus (Mongolian gerbil): 110564030
Entry
110564030         CDS       T05884                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4E-like
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110564030
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mun04054]
    110564030
Membrane trafficking [BR:mun04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110564030
Pattern recognition receptors [BR:mun04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   110564030
SSDB
Motif
Pfam: NACHT NLRC4_HD2 NOD2_WH AAA_16 HisK_N AAA_30
Other DBs
NCBI-GeneID: 110564030
NCBI-ProteinID: XP_021516979
LinkDB
Position
Unknown
AA seq 647 aa
MFNFDMLWNFSFVHTDSGNPKIYQAHLKKKLTQNWSRKLIIRGQDFFKQELTQEDYAYFE
DILVSKATGKKPQTVFLQGVAGIGKSLMLAKMMLAWSDGRVFQNKFSYIFYFCCDDVKQL
KTASLAELISREWPSPSAPIVEILSQPEKLLFIIDSLEGMKCDLTEWESEMCDNWMEKQP
VNILLSSLLRRKLLPESSLLISGTPEAFKKIEGRIECTNLEIITGLSEDNIKRYFYSLFR
DKNRAQEAYSVVRENEHLFTLCEVPLICWMVATCLKKEIEKGREPVAICRRTTSLYTTHI
FNLFIPQSARHLSKKSQAQLQGLCSLAAEGMWTDTFVFSEEDLRRNGIISSDISTLLDMR
ILLKSREPENCYIFLHPSVQEICAAVFYLLKSHVDHPSQDVKCIKTLMFTFLKKVKVQWI
FLGCFIFGLLHESEQEKLVTFFGYQLSQEIIQQLYQCLETINDDDELQEQIDGMKLFYCL
FEMEDEAFLVQAMNCMRQINFVAKNYSDFMVATYCLRHCSTLRKLSFSTKILVLEVQEGR
EKLLVFWHHMCSVFINNDIQLLQVKDTHFSEQAFLLLYNHLKYLNCNLQVLEANNVYARD
THLFFALINQSRSLQHLNLSHTFLSETDVKLLCDVLNQAECNIKTLR
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgtttaactttgatatgttgtggaatttttcttttgtgcacactgactcaggaaaccca
aagatatatcaagctcatttgaaaaagaagctgacccaaaattggtccagaaagttgatc
atcagaggtcaggatttctttaagcaagaattgacccaggaagactatgcttattttgag
gacattcttgtatcaaaggcaactggaaagaagccacagacggtgttcctgcaaggagtg
gcaggaattggcaagtccctgatgttggcaaagatgatgctggcctggtcagatggccgt
gtgtttcagaacaaattctcctacatcttctacttctgctgtgacgatgtgaagcagttg
aagacagcaagcctggctgaactgatctccagagagtggcccagcccctcagctcccata
gtggagatattatcccaacctgagaaactcttatttatcattgacagcttggaagggatg
aaatgtgatttgaccgaatgggaatcagagatgtgtgataattggatggagaagcagcca
gtgaatatactgctgagcagtttgctcaggaggaagctactccctgaatcctctctcctt
atctcaggtacaccagaggcttttaagaaaatagagggtaggattgagtgcacaaatttg
gaaataataacaggactcagtgaggacaatattaagaggtatttctacagcttgttccga
gataagaacagagcccaggaagcctacagtgttgtgagagaaaatgagcatctgtttact
ctgtgtgaggtccctctgatctgctggatggtggctacttgtctgaagaaagaaatagag
aagggaagagagccagtcgccatctgccgacgtaccacctccctgtataccactcacatc
ttcaatttgttcattccccaaagtgcccgtcatctaagtaagaaaagccaagcccagctg
caaggcttgtgctccctggctgcagagggtatgtggactgacacatttgtgttcagcgag
gaggatctcaggagaaatgggatcattagttctgacatctccacactgctggacatgagg
atacttctaaagagcagggaacctgaaaactgttacatattcctccacccatctgtccag
gagatctgtgctgctgtcttttatctgctaaagagccacgtggaccaccctagtcaggat
gttaaatgtataaagacactcatgtttacgtttctaaagaaagtcaaagtacagtggatt
tttttgggctgtttcatctttggccttttgcacgaatcagaacaagaaaagctagtgaca
ttttttggctaccagctgtcccaggaaataatacagcagttgtatcagtgccttgaaacc
attaatgatgatgacgagcttcaagaacaaatagacggcatgaagttattttactgtctg
tttgagatggaggatgaggccttcttagtgcaagcaatgaactgtatgagacagattaac
tttgtggctaaaaattattctgattttatggttgctacctactgcttaagacattgttct
acactgaggaaactatccttttcaaccaaaattcttgtacttgaagtacaggaaggcagg
gaaaagttactcgtcttttggcatcatatgtgctctgtgttcataaataatgacatccag
ctactacaagtcaaagacactcatttcagtgagcaagcattcttgctcttgtataatcac
ctgaagtacctcaactgcaaccttcaagtacttgaggcaaataacgtgtatgcacgtgat
acccacctgttctttgcgttgataaatcagagccgaagtttgcagcacttgaacctcagc
cacacattcctctctgagactgatgtgaaattgttgtgtgatgtcttgaaccaggcagag
tgcaacataaaaactctgcggtaa

DBGET integrated database retrieval system