KEGG   Meriones unguiculatus (Mongolian gerbil): 110564633
Entry
110564633         CDS       T05884                                 

Gene name
Rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04014  Ras signaling pathway
mun04390  Hippo signaling pathway
mun04392  Hippo signaling pathway - multiple species
mun05200  Pathways in cancer
mun05206  MicroRNAs in cancer
mun05219  Bladder cancer
mun05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110564633 (Rassf1)
   04390 Hippo signaling pathway
    110564633 (Rassf1)
   04392 Hippo signaling pathway - multiple species
    110564633 (Rassf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110564633 (Rassf1)
   05206 MicroRNAs in cancer
    110564633 (Rassf1)
  09162 Cancer: specific types
   05219 Bladder cancer
    110564633 (Rassf1)
   05223 Non-small cell lung cancer
    110564633 (Rassf1)
SSDB
Motif
Pfam: Nore1-SARAH RA Mst1_SARAH DUF5111
Other DBs
NCBI-GeneID: 110564633
NCBI-ProteinID: XP_021517818
LinkDB
Position
Unknown
AA seq 270 aa
MGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRPRRDQDEPVERETPDL
SQAETEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARR
GTGRSTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFMVVDDPRKFALFERTER
HGQVYFRKLSGDEQPLKLRLLAGPSEKALSFVLKENDSGEVDWDAFSMPELHNFLRILQR
EEEEHLRQILQKYSRCRQKIQEALHACPLG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcgaggccgagactccctccttcgagatgacctggagcagcacgacgagcagtggc
tactgcagccaggaggactcggactcggagctcgagcagtacttcacggcgcggacctcg
ctcgtccgcaggcctcgccgggaccaggatgagcctgtagagcgggagacccctgatctt
tctcaagctgagactgagcagaaaatcaaggattacaatggccagatcaacagcaatctc
ttcatgagcctgaacaaggacggctcctatacaggcttcatcaaggttcagctgaaactg
gtacgtcctgtctcagtgccttccagcaagaaacctccttccttacaggacgcccggcgg
ggcacagggcggagcacagccgtgaagcgccgtacctccttttacttgcctaaggatgct
gttaagcacctgcatgttctgtctcgaacacgggctcgtgaggtcattgaggccctgctg
cgaaaattcatggtagtggatgatcctcgaaagttcgcactctttgagcgaactgaacgt
catggtcaagtatacttccggaaactatcgggtgatgagcagccattgaagctccggctt
cttgcggggcccagtgagaaggccctgagctttgtcttgaaggagaatgactccggggag
gtggattgggatgccttcagtatgcctgaactgcacaatttcctacgtatcctgcagcgg
gaagaagaagaacacctccgccagatcctgcagaagtattcccgctgccgccagaagatc
caggaggccctgcatgcctgtcccttggggtga

DBGET integrated database retrieval system