KEGG   Meriones unguiculatus (Mongolian gerbil): 110565033Help
Entry
110565033         CDS       T05884                                 

Gene name
Clec6a
Definition
(RefSeq) C-type lectin domain family 6 member A
  KO
K17514  C-type lectin domain family 6 member A
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110565033 (Clec6a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mun04054]
    110565033 (Clec6a)
   04091 Lectins [BR:mun04091]
    110565033 (Clec6a)
Pattern recognition receptors [BR:mun04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   110565033 (Clec6a)
Lectins [BR:mun04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    110565033 (Clec6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C CHORD Comm
Motif
Other DBs
NCBI-GeneID: 110565033
NCBI-ProteinID: XP_021518296
LinkDB All DBs
Position
Unknown
AA seq 191 aa AA seqDB search
MVQERQRRGKGVCWMLRLWSVAVISILLLSACFVASCVLTYQFTTDNPNRRLFELHTYHS
SISCFSEGTMVSEKMWGCCPNHWKPFGSSCYLISTKENFWSISEQNCVEMGAHLVVINTE
AEQALAITPLLPGFYEFDYFRVFMFWHPNEPNSPAERCASIVFWNPAKWAWNDVLCDTKR
RSICEMKKIYL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaagacagcgtcgaggaaagggagtctgctggatgctgagactctggtca
gttgctgtgatttccatcttactcctcagcgcctgtttcgttgcgagctgtgtgttgact
taccagtttacgacggacaaccccaatagaagactgtttgaactccatacatatcattcc
agtatcagctgcttcagtgaagggaccatggtgtcagaaaaaatgtggggatgctgccca
aatcactggaagccatttggctccagctgctacctcatttccaccaaggagaacttctgg
agcatcagtgagcagaactgcgttgagatgggagcccatttggtggtgatcaatactgaa
gctgagcaggctctggcaatcacacctttacttcctggtttttatgagtttgattacttt
agagtcttcatgttctggcacccaaatgagcccaattctcctgcagagcgatgtgcttcg
atagttttctggaatcctgcgaaatgggcttggaacgatgttttgtgtgatactaaacgg
cgttcaatatgtgaaatgaagaagatttatctatga

DBGET integrated database retrieval system