KEGG   Meriones unguiculatus (Mongolian gerbil): 110565332
Entry
110565332         CDS       T05884                                 

Gene name
Tlr4
Definition
(RefSeq) toll-like receptor 4
  KO
K10160  toll-like receptor 4
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04064  NF-kappa B signaling pathway
mun04066  HIF-1 signaling pathway
mun04145  Phagosome
mun04151  PI3K-Akt signaling pathway
mun04217  Necroptosis
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun05132  Salmonella infection
mun05133  Pertussis
mun05134  Legionellosis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05205  Proteoglycans in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05321  Inflammatory bowel disease
mun05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110565332 (Tlr4)
   04066 HIF-1 signaling pathway
    110565332 (Tlr4)
   04151 PI3K-Akt signaling pathway
    110565332 (Tlr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110565332 (Tlr4)
  09143 Cell growth and death
   04217 Necroptosis
    110565332 (Tlr4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110565332 (Tlr4)
   04620 Toll-like receptor signaling pathway
    110565332 (Tlr4)
   04621 NOD-like receptor signaling pathway
    110565332 (Tlr4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110565332 (Tlr4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110565332 (Tlr4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110565332 (Tlr4)
   05321 Inflammatory bowel disease
    110565332 (Tlr4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110565332 (Tlr4)
   05135 Yersinia infection
    110565332 (Tlr4)
   05133 Pertussis
    110565332 (Tlr4)
   05134 Legionellosis
    110565332 (Tlr4)
   05152 Tuberculosis
    110565332 (Tlr4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110565332 (Tlr4)
   05161 Hepatitis B
    110565332 (Tlr4)
   05171 Coronavirus disease - COVID-19
    110565332 (Tlr4)
   05164 Influenza A
    110565332 (Tlr4)
   05162 Measles
    110565332 (Tlr4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110565332 (Tlr4)
   05144 Malaria
    110565332 (Tlr4)
   05145 Toxoplasmosis
    110565332 (Tlr4)
   05140 Leishmaniasis
    110565332 (Tlr4)
   05142 Chagas disease
    110565332 (Tlr4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110565332 (Tlr4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mun04054]
    110565332 (Tlr4)
   04090 CD molecules [BR:mun04090]
    110565332 (Tlr4)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110565332 (Tlr4)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    110565332 (Tlr4)
Pattern recognition receptors [BR:mun04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   110565332 (Tlr4)
CD molecules [BR:mun04090]
 Proteins
  110565332 (Tlr4)
Glycosaminoglycan binding proteins [BR:mun00536]
 Hyaluronan
  Cell surface receptors
   110565332 (Tlr4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_1 LRR_9 DUF1863
Other DBs
NCBI-GeneID: 110565332
NCBI-ProteinID: XP_021518664
LinkDB
Position
Unknown
AA seq 838 aa
MMPPLLLAGTLIMALFLSCLRPESFDPCIEVDPNITYQCMEQNLNKIPENIPSSTKNLDL
SFNPLKILGSHSFSNFSELQLLDLTRCEIETIEDKAYHGLNQLSTLILTGNPIQSLSVKS
FSGLTSLENLVAVETQLASLESFPIGQLIALKRLNVAHNLIHSSKLPEYFSNLTNLQHLD
LSNNYIQTIYHKDLQVLRENPHFNLSLDLSLNPIDFIQPHSFQGIRLHELTLRSNFNSTN
VMKTCIQNLAGLQVHRLILGEFKNEKNVERFDNSVMEELCKLTIDEFHLTYADYFSDDIT
DFNCLANVSAVSLASVYLRHLENIPKHFKWRSLTVTRCELKQFPLLELPFLKRLILTTNK
GATSFEDVDLPSLTFLDLSRNSLSFSGCCSDSHLGTNRLKHLDLSYNGVIRMSSNFMGLE
ELEYLDFQHSTLKEVSEFSVFLSLEKLLYLDISYTNTKIGFEGIFLGLISLNTLKMAGNS
FKDNTLSNVFTITTNLTFLDLSKCQLQRVSWGVFDKLSRLQLLNMSHNNLLILDPFHYKQ
LYSLKTLDCSFNRIETAKGILQHFPNSLTFLNLTNNSLACTCEHQNFLQWVKDQRMLLVN
AEQMKCATPIDLKDSLVLDFRNATCYMHKTIITVSVMSVLVVTTIAFLIYKFYFHLVLIA
GCKKYNRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANI
IQEGFHKSRKVIVVVSRHFIQSRWCVFEYEIAQTWQFLSSRSGLIFIVLEKVEKSLLRQQ
VELYRLLSKNTYLEWEDNALGRHIFWRRLRKALLDGKACNPEGTAEEVCNHQEAATCT
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgatgcctcccttgctcctggctgggactctgatcatggcgttgttcctctcctgcctg
agacctgaaagcttcgatccctgcatagaggtggatcctaatattacataccaatgtatg
gaacagaatctcaacaaaatccctgaaaacatcccctcttcaaccaagaacttagatctg
agcttcaaccccctgaagatcttaggaagccatagcttctctaatttctctgaacttcaa
ttgctggacttaaccaggtgtgaaattgagacaattgaagataaggcgtatcatggccta
aaccagctctcaaccttgatactgacaggaaaccctatccagagtttatccgtgaaaagc
ttttctggattaacaagtttagaaaatctggtggctgtggagacacaactggcttctcta
gaaagcttccctattggacaacttattgctttaaaaagactcaatgtcgctcacaatctt
atacattcctccaagttaccagaatatttttctaacctgaccaacctacaacacttggac
ctttctaataactatattcaaactatttaccacaaagacttacaggttctacgcgaaaat
ccccacttcaatctctctttggacctgtctttgaacccaattgacttcattcaacctcat
tcctttcaaggaattaggctccatgaactgactctgcgaagtaattttaatagcacaaat
gtaatgaaaacttgcattcaaaacctggctggattacaagtccatcggttgatcttggga
gaatttaaaaatgaaaagaatgtagaaagatttgacaattctgtcatggaagaactgtgt
aaattgactattgatgagttccatttgacatatgcagattacttttcagatgatattact
gacttcaattgcttggcaaatgtttctgcagtgtctctggcaagtgtatatttaagacac
ctcgaaaatattcctaaacacttcaagtggcgatccttaacagtcactagatgtgagctt
aagcagtttccacttctggaactaccctttcttaaaagattgattttaactaccaacaaa
ggggctaccagttttgaggacgtggatctgccaagtctcacatttctagatctcagtaga
aatagcctgagctttagtggttgctgttctgattctcatttggggacaaacagactgaag
cacttagacctcagctacaatggtgtcatccgtatgagttcaaacttcatgggtctagaa
gaactggaatacctggattttcagcattccactttaaaagaggtctcggaattctcagtg
ttcttatcccttgaaaaactcctgtaccttgatatctcttatactaacactaaaattggc
tttgaaggcatatttcttggcttgatcagtctcaacaccttaaaaatggctggcaattct
ttcaaagacaacacactttcaaatgtcttcacaattacaacaaacttgacattcctggat
ctttctaaatgccagttgcaacgtgtgtcttggggtgtgtttgacaaactcagtagactt
cagttactgaatatgagtcacaacaacctactgattttggacccattccattataaacag
ctgtactccctgaagactctggattgcagtttcaatcgcatagagacagccaaaggaatt
ctgcaacattttccaaatagcctaaccttcttaaatcttactaataattctctggcttgt
acatgtgaacatcagaacttcctgcagtgggtcaaggaccagaggatgctcttggtgaat
gctgaacaaatgaaatgtgcaacacctatagacctgaaggactccctggtgttggatttt
aggaatgctacatgttatatgcacaagactatcatcactgtgtcagtgatgagtgtgctt
gtggtgaccactatagcatttctgatctacaaattctattttcacctggtacttattgct
ggctgtaaaaagtacaacagaggtgaaagcatctatgatgcctttgtcatctattcaagc
cagaatgaggactgggtgagaaatgagttggtaaagaatttagaagaaggagttccccca
tttcagctctgtcttcattacagagacttcattcctggggtagccattgctgccaacatc
atccaggaaggcttccacaagagccggaaggttattgtggtggtgtctagacattttata
cagagccgctggtgtgtctttgaatatgagattgctcagacatggcagtttctgagcagc
cgctctggcctcatcttcattgtgctggagaaggtagagaagtccctgcttaggcagcag
gtagagttgtatcgccttctcagcaagaacacctacttagagtgggaggacaatgctctg
gggaggcacatcttctggagaagactcagaaaagccctgttagatgggaaagcctgtaat
ccagagggaacagcagaggaagtgtgcaatcaccaagaagcagcaacttgcacctga

DBGET integrated database retrieval system