KEGG   Meriones unguiculatus (Mongolian gerbil): 110565383
Entry
110565383         CDS       T05884                                 

Gene name
Atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04022  cGMP-PKG signaling pathway
mun04141  Protein processing in endoplasmic reticulum
mun04151  PI3K-Akt signaling pathway
mun04211  Longevity regulating pathway
mun04261  Adrenergic signaling in cardiomyocytes
mun04668  TNF signaling pathway
mun04728  Dopaminergic synapse
mun04911  Insulin secretion
mun04915  Estrogen signaling pathway
mun04918  Thyroid hormone synthesis
mun04925  Aldosterone synthesis and secretion
mun04926  Relaxin signaling pathway
mun04927  Cortisol synthesis and secretion
mun04928  Parathyroid hormone synthesis, secretion and action
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun05020  Prion disease
mun05030  Cocaine addiction
mun05031  Amphetamine addiction
mun05034  Alcoholism
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110565383 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110565383 (Atf6b)
   04022 cGMP-PKG signaling pathway
    110565383 (Atf6b)
   04151 PI3K-Akt signaling pathway
    110565383 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110565383 (Atf6b)
   04915 Estrogen signaling pathway
    110565383 (Atf6b)
   04926 Relaxin signaling pathway
    110565383 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    110565383 (Atf6b)
   04918 Thyroid hormone synthesis
    110565383 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    110565383 (Atf6b)
   04925 Aldosterone synthesis and secretion
    110565383 (Atf6b)
   04927 Cortisol synthesis and secretion
    110565383 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110565383 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110565383 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    110565383 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110565383 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    110565383 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    110565383 (Atf6b)
   05031 Amphetamine addiction
    110565383 (Atf6b)
   05034 Alcoholism
    110565383 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110565383 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110565383 (Atf6b)
   05161 Hepatitis B
    110565383 (Atf6b)
   05163 Human cytomegalovirus infection
    110565383 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110565383 (Atf6b)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110565383 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 110565383
NCBI-ProteinID: XP_021518732
LinkDB
Position
Unknown
AA seq 710 aa
MVGGGGKMAELMLLSEIADPTRFFTDNLLSPEDWGVRNSTLYSGLDEVAEEQTQLFRCVE
QDVPFDSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPPS
QVPGVGEILPVKMESLAPPLCLLGDDPSSPFETIQITVGSASDDPSDIQTKLEPASPSCS
VNSEASLLSADSPSQAFIGEEVLEVKTESPSPPGCLLWDVPAPSLGAVQISMGPSPDSSS
GKAPATRKPPLQPKPVVLTTVQVPPRAGPPSATVLLQPLVQQPAVSPVVLIQGAVRVQPE
GPAPAIPRPERKSIVPAPMPGGSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGL
EARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGP
VSIVEPPPAPASPRMGREEPRPQRHLLEFLEQGPPGGVEPLQEASQGPEEQHPSPVGKPS
FRNLTAFPSGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQR
ARERQKSQLWKKSPPVKAVPTQPPGPPEMDAVGQLQLYRHPGRSQPEFLDAIDRREDTFY
VVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEEMMQIECEVMDTR
VIHIKTSTVPPSLRKQPSPAPGNTTGGPLPASAARQARRASHQPLYLNHP
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggtggggggtggggggaagatggcggagctgatgctcctcagcgagatcgccgacccg
acgcgcttcttcaccgacaacctgctgagtccggaggactggggtgtgcggaacagcacc
ttgtacagtggcctggatgaagtggccgaggagcagacacagttgtttcgttgcgtggag
caagatgtcccgtttgacagcagctctctggatgtggggatggatgtcagcccccctgag
cccccctgggaccctctacccatcttcccagaccttcaggtgaagtctgagccgtcctcc
ccctgctcttcctcctccctcagctcagagtcgtcacatctttccacagagccccccagc
caggttcctggagtaggggaaatactgcccgtgaagatggagtccttagcacccccactc
tgcctgctgggagatgacccatcatccccatttgaaaccatccagatcactgtgggctct
gcctctgatgatccctcagatatccagaccaagctagaacccgcctctccatcttgttcc
gtcaactccgaggcctccctcctctcagcagattctcccagccaggctttcataggagag
gaggttctggaagtgaagacagagtccccgtcccctccagggtgcctcctgtgggatgtc
ccagccccttcacttggagctgtccagatcagcatgggtccgtcccctgatagttcctca
gggaaagctccggccactcggaagcctccactgcagcccaaacctgtggtgctgaccaca
gttcaggtgccacccagagctgggcctcccagcgctaccgtcctcctgcaaccccttgtc
cagcagcccgccgtgtccccagtagtcctcatccaaggtgctgttcgagtccagcctgaa
gggccagcccccgccattccacggcccgagaggaagagcatcgttccagcccccatgcct
gggggctcctgcccgccggaggtggatgcaaagctgctgaagcggcagcagcggatgatc
aagaacagagagtcggcctgccagtcccgccgcaagaagaaagagtacctgcagggcctg
gaggccaggctgcaggccgtgctggccgacaaccagcagctgcgcagggagaacgccgcc
ctccggcggcggctggaggccctgctggcagagaacagcgagctcaagctgggctctgga
aacaggaaggtcgtctgcatcatggtcttccttctcttcattgccttcaactttggacct
gtgagcatcgttgagccacctccagctccagcctcccctcggatgggcagggaggagccc
cggccccagaggcacctgctggagttcttggagcaagggccgcctggtggtgttgaaccc
ctacaggaagcgtcccagggccctgaggagcagcaccccagccctgtgggcaagcccagc
ttcagaaacctgacggccttccccagcggggccaaggagctgctgctcagagacctggac
cagctcttcctgtcttctgactgccgccactttaaccgaactgagtccctgaggcttgct
gatgagctgagtggctgggtccagcgtcaccagagaggacgacggaaaatacctcagagg
gcccgtgagagacagaagtctcagctatggaagaagtcacctccagtgaaagcagttccc
acccagcctccgggacctcctgaaatggacgctgtggggcagctgcagctctaccgccac
ccaggccgctcccagccggagtttctggatgccatcgaccggcgggaagacaccttctat
gttgtctccttccgcagggaccacttgctcctcccagccatcagccacaacaagacctcc
aggcccaagatgtccctggtgatgccagccatggcccccaatgagaccgtgtcaggccgg
gggcccccaggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagg
gtcatccacatcaagacctccacggtgcccccctcgctccggaagcagccgtccccagcc
ccgggcaataccacaggtggccccctgccagcctctgcagccaggcaggctcgccgggcc
tcccaccagcccctctacctcaaccatccctga

DBGET integrated database retrieval system