KEGG   Meriones unguiculatus (Mongolian gerbil): 110565488
Entry
110565488         CDS       T05884                                 

Gene name
Ppif
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase F, mitochondrial
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04020  Calcium signaling pathway
mun04022  cGMP-PKG signaling pathway
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05016  Huntington disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110565488 (Ppif)
   04022 cGMP-PKG signaling pathway
    110565488 (Ppif)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110565488 (Ppif)
   05012 Parkinson disease
    110565488 (Ppif)
   05016 Huntington disease
    110565488 (Ppif)
   05017 Spinocerebellar ataxia
    110565488 (Ppif)
   05020 Prion disease
    110565488 (Ppif)
   05022 Pathways of neurodegeneration - multiple diseases
    110565488 (Ppif)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110565488 (Ppif)
Enzymes [BR:mun01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110565488 (Ppif)
Chaperones and folding catalysts [BR:mun03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110565488 (Ppif)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 110565488
NCBI-ProteinID: XP_021518853
LinkDB
Position
Unknown
AA seq 204 aa
MLALRCCPRLLGLLSGPRAAPPLLSATRACSGGAARDSSSRNPLVYLDVGADGQPLGRVV
LELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGS
RFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTTKTDWLDGKHVVFGHVKEGMDVVKK
IESFGSKSGKTSKKIVITDCGQLS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgttggcgctgcgctgctgcccccgcctgctcggtctgctctccggccctcgcgctgcg
ccgccgctcctgtccgcgacccgcgcctgcagcggcggcgcagcccgcgactcctcctcg
cggaacccgcttgtgtacctggatgtgggcgccgacgggcagccgctcggccgcgtggtg
ctggagctaaaggcagatgtcgtgccaaagacagcagaaaacttcagagccctgtgcact
ggtgaaaagggctttggctacaaaggttccaccttccacagggtgatcccagccttcatg
tgccaggctggcgacttcaccaaccacaatggcacaggagggaagtccatctatggaagc
cggtttcctgacgagaactttacactgaagcacgtggggccaggtgtcctgtccatggca
aatgcgggccccaacaccaatggctctcagttctttatctgcacaacaaagacagactgg
ctggatggcaagcatgtcgtgtttggccatgtcaaagagggcatggatgttgtgaagaaa
atagaatcttttggctcaaaaagtgggaagacatctaagaagattgtcatcacagactgc
ggccagttgagctaa

DBGET integrated database retrieval system