KEGG   Meriones unguiculatus (Mongolian gerbil): 110565808
Entry
110565808         CDS       T05884                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04140  Autophagy - animal
mun04152  AMPK signaling pathway
mun04310  Wnt signaling pathway
mun04380  Osteoclast differentiation
mun04520  Adherens junction
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04660  T cell receptor signaling pathway
mun04668  TNF signaling pathway
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05161  Hepatitis B
mun05162  Measles
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110565808
   04310 Wnt signaling pathway
    110565808
   04064 NF-kappa B signaling pathway
    110565808
   04668 TNF signaling pathway
    110565808
   04152 AMPK signaling pathway
    110565808
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110565808
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110565808
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110565808
   04620 Toll-like receptor signaling pathway
    110565808
   04621 NOD-like receptor signaling pathway
    110565808
   04622 RIG-I-like receptor signaling pathway
    110565808
   04660 T cell receptor signaling pathway
    110565808
   04657 IL-17 signaling pathway
    110565808
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110565808
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110565808
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110565808
   05135 Yersinia infection
    110565808
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110565808
   05161 Hepatitis B
    110565808
   05171 Coronavirus disease - COVID-19
    110565808
   05162 Measles
    110565808
   05168 Herpes simplex virus 1 infection
    110565808
   05169 Epstein-Barr virus infection
    110565808
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110565808
   05140 Leishmaniasis
    110565808
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110565808
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     110565808
Protein kinases [BR:mun01001]
 Serine/threonine kinases: TKL group
  MLK family
   110565808
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 110565808
NCBI-ProteinID: XP_021519254
LinkDB
Position
Unknown
AA seq 585 aa
MVVERVSVATKAPMAGVPRVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQL
SRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGV
AYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVF
EGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIES
LMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMD
IASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSETGRLSLGASRGSSVDSLPP
ASEGKRMSADMSEIEARIVATAAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQ
DLTVTGPEPGQVSSRSSSPSVRMITTSGPTSEKPARSHPWTPDDSTDTNGSDNSIPMAYL
TLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQ
QNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggtggtggagcgggtttcagtggccaccaaggcacctatggctggggttccaagggtt
gttggaagaggagcttttggagtggtttgcaaggctaagtggagagcaaaggatgttgct
attaaacaaatagaaagtgaatctgagaggaaggctttcattgtggagctccggcagttg
tcgcgtgtgaaccatcctaatattgtaaaattgtatggagcctgcttgaatccagtatgt
cttgtgatggagtatgctgagggaggctccttgtacaatgtgctgcatggtgctgaacca
ttgccttattacactgctgcccatgccatgagttggtgtttacagtgttcccaaggagtg
gcttatctgcacagcatgcagcccaaagctctaattcacagggacctcaagcctccaaac
ctgctgctggttgcaggagggacagttctaaaaatctgcgattttggtacagcttgtgat
atccagacacacatgaccaataataaagggagtgctgcttggatggcccccgaagtattt
gaaggtagcaattacagtgaaaagtgtgatgtcttcagctggggtattatcctttgggag
gtgataacacgccggaaaccctttgatgagattggtggcccagctttccgaatcatgtgg
gctgttcataatggtactcgaccaccgctgatcaaaaatctacctaagcccattgagagc
ctgatgacccgctgttggtctaaggacccttctcagcgcccttcaatggaggaaattgtg
aaaataatgactcacttgatgcggtactttccaggagcggatgagccgttacagtatcct
tgtcagtactctgacgaagggcagagcaactcagccaccagcacaggctcatttatggac
atcgcttctacaaataccagtaataaaagtgacactaatatggaacaagttcctgccaca
aatgatactattaaacgcttagagtcaaaactgttgaaaaatcaggcaaagcaacagagt
gaaaccggacggctgagcctgggggcctctcgtgggagcagtgtggacagcctgcccccg
gcttcggagggcaagcggatgagtgctgacatgtctgagatagaagccaggatcgttgcc
actgcagcctattccaagcctaaacggggccaccgtaaaaccgcttcatttggcaacatt
ctggatgtccctgagatcgtcatatcaggcaatgggcaaccaaggcgtagatccatccaa
gacttgactgtcactgggccagaacctggtcaggtgagcagtaggtcatccagtcctagt
gtcagaatgatcactacctcaggaccaacctcagagaagccagctcgcagtcacccatgg
acccctgatgattccacagataccaatggttcggataactccatcccaatggcgtatctt
acactggatcaccagctgcagcctctagcaccctgcccaaactccaaagaatccatggca
gtgtttgaacaacactgtaagatggcacaggaatatatgaaagttcaaaccgaaatcgcg
ttgttgcttcagagaaagcaagaactagttgcagaattggaccaggatgaaaaggaccag
caaaatacatctcgtctggtacaggaacataaaaagcttttagatgaaaacaaaagcctt
tctacttactaccagcaatgtaaaaaacaactagaggtcatcagaagccaacagcagaaa
cgacaaggcacttcatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110565809
Entry
110565809         CDS       T05884                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7-like
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04140  Autophagy - animal
mun04152  AMPK signaling pathway
mun04310  Wnt signaling pathway
mun04380  Osteoclast differentiation
mun04520  Adherens junction
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04660  T cell receptor signaling pathway
mun04668  TNF signaling pathway
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05161  Hepatitis B
mun05162  Measles
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110565809
   04310 Wnt signaling pathway
    110565809
   04064 NF-kappa B signaling pathway
    110565809
   04668 TNF signaling pathway
    110565809
   04152 AMPK signaling pathway
    110565809
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110565809
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110565809
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110565809
   04620 Toll-like receptor signaling pathway
    110565809
   04621 NOD-like receptor signaling pathway
    110565809
   04622 RIG-I-like receptor signaling pathway
    110565809
   04660 T cell receptor signaling pathway
    110565809
   04657 IL-17 signaling pathway
    110565809
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110565809
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110565809
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110565809
   05135 Yersinia infection
    110565809
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110565809
   05161 Hepatitis B
    110565809
   05171 Coronavirus disease - COVID-19
    110565809
   05162 Measles
    110565809
   05168 Herpes simplex virus 1 infection
    110565809
   05169 Epstein-Barr virus infection
    110565809
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110565809
   05140 Leishmaniasis
    110565809
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110565809
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     110565809
Protein kinases [BR:mun01001]
 Serine/threonine kinases: TKL group
  MLK family
   110565809
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 110565809
NCBI-ProteinID: XP_021519255
LinkDB
Position
Unknown
AA seq 604 aa
MPYQYRLWNSQAAAIHLCVNLDHCSHQLQPVPYCSLAQVVGRGAFGVVCKAKWRAKDVAI
KQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPL
PYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDI
QTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWA
VHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPC
QYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSE
TGRLSLGASRGSSVDSLPPASEGKRMSADMSEIEARIVATAAYSKPKRGHRKTASFGNIL
DVPEIVISGNGQPRRRSIQDLTVTGPEPGQVSSRSSSPSVRMITTSGPTSEKPARSHPWT
PDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIAL
LLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKR
QGTS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgccgtatcagtaccggctttggaactcccaagctgcggccattcacttgtgtgtcaac
ttggatcactgcagccaccaactccagcccgtcccttattgctccctggctcaggttgtt
ggaagaggagcttttggagtggtttgcaaggctaagtggagagcaaaggatgttgctatt
aaacaaatagaaagtgaatctgagaggaaggctttcattgtggagctccggcagttgtcg
cgtgtgaaccatcctaatattgtaaaattgtatggagcctgcttgaatccagtatgtctt
gtgatggagtatgctgagggaggctccttgtacaatgtgctgcatggtgctgaaccattg
ccttattacactgctgcccatgccatgagttggtgtttacagtgttcccaaggagtggct
tatctgcacagcatgcagcccaaagctctaattcacagggacctcaagcctccaaacctg
ctgctggttgcaggagggacagttctaaaaatctgcgattttggtacagcttgtgatatc
cagacacacatgaccaataataaagggagtgctgcttggatggcccccgaagtatttgaa
ggtagcaattacagtgaaaagtgtgatgtcttcagctggggtattatcctttgggaggtg
ataacacgccggaaaccctttgatgagattggtggcccagctttccgaatcatgtgggct
gttcataatggtactcgaccaccgctgatcaaaaatctacctaagcccattgagagcctg
atgacccgctgttggtctaaggacccttctcagcgcccttcaatggaggaaattgtgaaa
ataatgactcacttgatgcggtactttccaggagcggatgagccgttacagtatccttgt
cagtactctgacgaagggcagagcaactcagccaccagcacaggctcatttatggacatc
gcttctacaaataccagtaataaaagtgacactaatatggaacaagttcctgccacaaat
gatactattaaacgcttagagtcaaaactgttgaaaaatcaggcaaagcaacagagtgaa
accggacggctgagcctgggggcctctcgtgggagcagtgtggacagcctgcccccggct
tcggagggcaagcggatgagtgctgacatgtctgagatagaagccaggatcgttgccact
gcagcctattccaagcctaaacggggccaccgtaaaaccgcttcatttggcaacattctg
gatgtccctgagatcgtcatatcaggcaatgggcaaccaaggcgtagatccatccaagac
ttgactgtcactgggccagaacctggtcaggtgagcagtaggtcatccagtcctagtgtc
agaatgatcactacctcaggaccaacctcagagaagccagctcgcagtcacccatggacc
cctgatgattccacagataccaatggttcggataactccatcccaatggcgtatcttaca
ctggatcaccagctgcagcctctagcaccctgcccaaactccaaagaatccatggcagtg
tttgaacaacactgtaagatggcacaggaatatatgaaagttcaaaccgaaatcgcgttg
ttgcttcagagaaagcaagaactagttgcagaattggaccaggatgaaaaggaccagcaa
aatacatctcgtctggtacaggaacataaaaagcttttagatgaaaacaaaagcctttct
acttactaccagcaatgtaaaaaacaactagaggtcatcagaagccaacagcagaaacga
caaggcacttcatga

DBGET integrated database retrieval system