KEGG   Meriones unguiculatus (Mongolian gerbil): 110566367
Entry
110566367         CDS       T05884                                 

Definition
(RefSeq) tumor necrosis factor alpha-induced protein 3 isoform X1
  KO
K11859  tumor necrosis factor, alpha-induced protein 3 [EC:3.4.19.12]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04064  NF-kappa B signaling pathway
mun04217  Necroptosis
mun04621  NOD-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04668  TNF signaling pathway
mun05162  Measles
mun05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110566367
   04668 TNF signaling pathway
    110566367
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110566367
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110566367
   04657 IL-17 signaling pathway
    110566367
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    110566367
   05169 Epstein-Barr virus infection
    110566367
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110566367
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110566367
Enzymes [BR:mun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     110566367
Peptidases and inhibitors [BR:mun01002]
 Cysteine peptidases
  Family C64
   110566367
Ubiquitin system [BR:mun04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    110566367
SSDB
Motif
Pfam: zf-A20 OTU
Other DBs
NCBI-GeneID: 110566367
NCBI-ProteinID: XP_021519880
LinkDB
Position
Unknown
AA seq 836 aa
MPSLQPSEPEAERRAARDAHTPRQTASWSGRPWGSASDRPPPRPGARPSAAARAQTDGSA
RPQQASSRTMAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMF
RTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAACQY
MWGVQDTDLVLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNL
VKMASADTPAARSGLQYNSLEEIHIFVLSNILRRPIIVISDKMLRSLESGSNFAPLKMGG
IYLPLHWPAQDCYRYPIVLGYDSQHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFL
TDPENKMKEKLLKEYLIVMEIPVQGWDHGTTHLISAAKLDEANLPKEINLVDDYFELVQH
EYKKWQESNDEGRREAHAQTPLEPSTPQLSLMDIKCETPNCPFFMSVNTQPLCHECSERH
QKNQSKLPKLNSKLGPEGLPGMGWSPEEAAGGPHSAPPTAPSLFLFSETTAMKCRSPGCP
FTLNVQHNGFCERCHNARQLNVSHTADPGKCQACHQDVTRTFNGICSTCFKRTTAEPFSS
LTSSVPPSCHQRSKSDPSQLIQSLTPHSCHQTGNDIPSGCLSQAARTPGDRTGTSKCRKA
GCMYFGTPERKGFCTLCFLEYRENKQFVAASGKAPRFQNNIPCLGRECGTLGSTMFEGYC
QKCFIEAQNQRFHEAKRTEEQLRSSQRRDLPQTTQGASRSKCARASCKNILACRSEELCM
ECQHLSQRVGPMAHRGEPSPEEPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgcccagtctgcagccctcggagccggaggcggagcggcgagcggcgagagacgcgcac
acccccagacagacggcgagctggagcgggcgcccatggggctccgcctcggaccgaccc
ccaccccgacccggagcgcgaccttcggctgcggcgcgtgcacagactgacggctccgcg
cggccccagcaggcctcgtcaaggaccatggctgaacaactccttcctcaggctttgtat
ttgagcaatatgcggaaagctgtgaagatacgagagagaactccagaagacattttcaaa
cctaccaatgggatcatccatcattttaaaaccatgcaccgatacacgctggagatgttc
agaacatgtcagttttgcccacagtttcgggagatcatccacaaggcgcttattgacaga
agtgtccaggcttccctggaaagccagaagaagttgaattggtgtcgtgaagtcaggaag
cttgtggctctgaaaaccaatggtgatggaaattgcctcatgcatgcagcttgtcagtac
atgtggggtgttcaggatactgacttggtcctgaggaaggccctctgcagcaccctcaag
gagacggacacacggaactttaaattccgctggcagctggagtctctcaaatctcaggaa
tttgtggaaacaggactttgctacgacactcggaactggaatgacgaatgggacaacttg
gtcaaaatggcatcagcagacacgcctgctgcccgaagtggacttcagtataattccctg
gaagaaatccacatatttgtcctcagcaacattctcagaagacccatcattgtcatttca
gacaaaatgctaagaagtttggaatcaggttccaattttgctcctttgaaaatgggtggg
atttacctgcctctccactggcctgcgcaagactgttacagatatcccatcgtccttggc
tatgacagccagcactttgttcccctggtgaccctgaaggacagtggacctgaaattcga
gctgttccacttgttaacagagaccggggaagatttgaagacttaaaagttcactttttg
acagaccctgaaaacaagatgaaggaaaagcttctaaaggagtacttgattgtgatggaa
attcctgtgcaaggctgggaccatggcacgactcaccttatcagtgctgcaaagttggat
gaagctaacttacccaaagaaataaatctggtagatgattactttgaacttgttcaacat
gaatacaagaaatggcaggaaagtaatgatgagggcaggagagaggcacatgcacaaacc
cctttggaaccttccacaccccagctatcactcatggatataaaatgtgagacacccaac
tgtcctttcttcatgtctgtgaacactcagcctttatgccatgaatgctcagagaggcac
caaaaaaaccagagcaaactcccaaagctgaactcaaagctgggccctgaaggactccca
ggcatgggttggagccctgaagaagcagctggaggacctcattcggccccacccacagca
cccagcctttttctgttcagcgagaccactgcaatgaagtgcaggagccctggatgccct
ttcaccttgaatgtgcagcataatggattctgtgagcgttgccacaatgcccggcagctt
aatgtcagccatactgcagatcctggtaagtgccaagcttgccatcaggatgtcactcgg
acatttaatggcatctgcagtacctgtttcaaaaggactacagcagagcccttctccagc
ctcacttccagtgtccctccctcctgtcaccaacgctccaagtctgacccctcacaactc
atccaaagtctcaccccacactcttgccaccaaactggaaatgacatcccctctggctgc
ctttcccaggcagcacgaactccaggagacagaacggggacaagcaagtgcagaaaagct
ggctgcatgtattttgggactccagaaagaaagggcttttgcacgctgtgtttcctcgaa
tacagagaaaataaacagtttgtcgctgcctctgggaaagcccccaggttccaaaacaac
atcccatgcctgggcagggaatgtggcacgcttggaagcaccatgtttgaaggatactgt
cagaagtgtttcattgaagctcagaaccagagatttcatgaagcaaaaaggactgaagaa
caactgagatccagccagcggagagacttgcctcaaaccacacagggagcctcaaggtcc
aaatgtgcccgggcttcctgcaagaacatcctggcctgtcgcagtgaggagctctgcatg
gagtgccagcacctaagccagcgagtgggacctatggcccaccggggtgagcccagtcct
gaagagccccctaaacagcgctgccgggcccctgcttgtgatcacttcggcaatgccaag
tgtaacggttactgcaacgagtgcttccagttcaagcagatgtatggctaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110566369
Entry
110566369         CDS       T05884                                 

Definition
(RefSeq) tumor necrosis factor alpha-induced protein 3 isoform X1
  KO
K11859  tumor necrosis factor, alpha-induced protein 3 [EC:3.4.19.12]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04064  NF-kappa B signaling pathway
mun04217  Necroptosis
mun04621  NOD-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04668  TNF signaling pathway
mun05162  Measles
mun05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110566369
   04668 TNF signaling pathway
    110566369
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110566369
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110566369
   04657 IL-17 signaling pathway
    110566369
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    110566369
   05169 Epstein-Barr virus infection
    110566369
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110566369
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110566369
Enzymes [BR:mun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     110566369
Peptidases and inhibitors [BR:mun01002]
 Cysteine peptidases
  Family C64
   110566369
Ubiquitin system [BR:mun04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    110566369
SSDB
Motif
Pfam: zf-A20 OTU
Other DBs
NCBI-GeneID: 110566369
NCBI-ProteinID: XP_021519883
LinkDB
Position
Unknown
AA seq 846 aa
MDMTWKAASEMPSLQPSEPEAERRAARDAHTPRQTASWSGRPWGSASDRPPPRPGARPSA
AARAQTDGSARPQQASSRTMAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFK
TMHRYTLEMFRTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDG
NCLMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDT
RNWNDEWDNLVKMASADTPAARSGLQYNSLEEIHIFVLSNILRRPIIVISDKMLRSLESG
SNFAPLKMGGIYLPLHWPAQDCYRYPIVLGYDSQHFVPLVTLKDSGPEIRAVPLVNRDRG
RFEDLKVHFLTDPENKMKEKLLKEYLIVMEIPVQGWDHGTTHLISAAKLDEANLPKEINL
VDDYFELVQHEYKKWQESNDEGRREAHAQTPLEPSTPQLSLMDIKCETPNCPFFMSVNTQ
PLCHECSERHQKNQSKLPKLNSKLGPEGLPGMGWSPEEAAGGPHSAPPTAPSLFLFSETT
AMKCRSPGCPFTLNVQHNGFCERCHNARQLNVSHTADPGKCQACHQDVTRTFNGICSTCF
KRTTAEPFSSLTSSVPPSCHQRSKSDPSQLIQSLTPHSCHQTGNDIPSGCLSQAARTPGD
RTGTSKCRKAGCMYFGTPERKGFCTLCFLEYRENKQFVAASGKAPRFQNNIPCLGRECGT
LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDLPQTTQGASRSKCARASCKNI
LACRSEELCMECQHLSQRVGPMAHRGEPSPEEPPKQRCRAPACDHFGNAKCNGYCNECFQ
FKQMYG
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggatatgacgtggaaggcagcttccgaaatgcccagtctgcagccctcggagccggag
gcggagcggcgagcggcgagagacgcgcacacccccagacagacggcgagctggagcggg
cgcccatggggctccgcctcggaccgacccccaccccgacccggagcgcgaccttcggct
gcggcgcgtgcacagactgacggctccgcgcggccccagcaggcctcgtcaaggaccatg
gctgaacaactccttcctcaggctttgtatttgagcaatatgcggaaagctgtgaagata
cgagagagaactccagaagacattttcaaacctaccaatgggatcatccatcattttaaa
accatgcaccgatacacgctggagatgttcagaacatgtcagttttgcccacagtttcgg
gagatcatccacaaggcgcttattgacagaagtgtccaggcttccctggaaagccagaag
aagttgaattggtgtcgtgaagtcaggaagcttgtggctctgaaaaccaatggtgatgga
aattgcctcatgcatgcagcttgtcagtacatgtggggtgttcaggatactgacttggtc
ctgaggaaggccctctgcagcaccctcaaggagacggacacacggaactttaaattccgc
tggcagctggagtctctcaaatctcaggaatttgtggaaacaggactttgctacgacact
cggaactggaatgacgaatgggacaacttggtcaaaatggcatcagcagacacgcctgct
gcccgaagtggacttcagtataattccctggaagaaatccacatatttgtcctcagcaac
attctcagaagacccatcattgtcatttcagacaaaatgctaagaagtttggaatcaggt
tccaattttgctcctttgaaaatgggtgggatttacctgcctctccactggcctgcgcaa
gactgttacagatatcccatcgtccttggctatgacagccagcactttgttcccctggtg
accctgaaggacagtggacctgaaattcgagctgttccacttgttaacagagaccgggga
agatttgaagacttaaaagttcactttttgacagaccctgaaaacaagatgaaggaaaag
cttctaaaggagtacttgattgtgatggaaattcctgtgcaaggctgggaccatggcacg
actcaccttatcagtgctgcaaagttggatgaagctaacttacccaaagaaataaatctg
gtagatgattactttgaacttgttcaacatgaatacaagaaatggcaggaaagtaatgat
gagggcaggagagaggcacatgcacaaacccctttggaaccttccacaccccagctatca
ctcatggatataaaatgtgagacacccaactgtcctttcttcatgtctgtgaacactcag
cctttatgccatgaatgctcagagaggcaccaaaaaaaccagagcaaactcccaaagctg
aactcaaagctgggccctgaaggactcccaggcatgggttggagccctgaagaagcagct
ggaggacctcattcggccccacccacagcacccagcctttttctgttcagcgagaccact
gcaatgaagtgcaggagccctggatgccctttcaccttgaatgtgcagcataatggattc
tgtgagcgttgccacaatgcccggcagcttaatgtcagccatactgcagatcctggtaag
tgccaagcttgccatcaggatgtcactcggacatttaatggcatctgcagtacctgtttc
aaaaggactacagcagagcccttctccagcctcacttccagtgtccctccctcctgtcac
caacgctccaagtctgacccctcacaactcatccaaagtctcaccccacactcttgccac
caaactggaaatgacatcccctctggctgcctttcccaggcagcacgaactccaggagac
agaacggggacaagcaagtgcagaaaagctggctgcatgtattttgggactccagaaaga
aagggcttttgcacgctgtgtttcctcgaatacagagaaaataaacagtttgtcgctgcc
tctgggaaagcccccaggttccaaaacaacatcccatgcctgggcagggaatgtggcacg
cttggaagcaccatgtttgaaggatactgtcagaagtgtttcattgaagctcagaaccag
agatttcatgaagcaaaaaggactgaagaacaactgagatccagccagcggagagacttg
cctcaaaccacacagggagcctcaaggtccaaatgtgcccgggcttcctgcaagaacatc
ctggcctgtcgcagtgaggagctctgcatggagtgccagcacctaagccagcgagtggga
cctatggcccaccggggtgagcccagtcctgaagagccccctaaacagcgctgccgggcc
cctgcttgtgatcacttcggcaatgccaagtgtaacggttactgcaacgagtgcttccag
ttcaagcagatgtatggctaa

DBGET integrated database retrieval system