KEGG   Meriones unguiculatus (Mongolian gerbil): 110566894
Entry
110566894         CDS       T05884                                 

Definition
(RefSeq) C-C chemokine receptor type 5
  KO
K04180  C-C chemokine receptor type 5
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04061  Viral protein interaction with cytokine and cytokine receptor
mun04062  Chemokine signaling pathway
mun04144  Endocytosis
mun05145  Toxoplasmosis
mun05163  Human cytomegalovirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05170  Human immunodeficiency virus 1 infection
mun05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110566894
   04061 Viral protein interaction with cytokine and cytokine receptor
    110566894
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110566894
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110566894
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110566894
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110566894
   05163 Human cytomegalovirus infection
    110566894
   05167 Kaposi sarcoma-associated herpesvirus infection
    110566894
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110566894
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mun04030]
    110566894
   04050 Cytokine receptors [BR:mun04050]
    110566894
   04090 CD molecules [BR:mun04090]
    110566894
G protein-coupled receptors [BR:mun04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    110566894
Cytokine receptors [BR:mun04050]
 Chemokine receptors
  CC Chemokine
   110566894
CD molecules [BR:mun04090]
 Proteins
  110566894
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 110566894
NCBI-ProteinID: XP_021520470
LinkDB
Position
Unknown
AA seq 354 aa
MDLQESTTTFNYDNDYDTSAPCQKTDVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC
KKLKNMTDIYLFNLAISDLLFLLTLPVWAHYAANEWVFGNIMCKLFTGLYHIGYFGGIFF
IILLTIDRYLAIVHAVFALKARTVPFGVMTSGVTWVVVMFASLPEIVFTRSQKEGFHYTC
SPHFPHTQYHFWKSFQTLKMVILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIF
AIMIVYFLFWTPYNIVLLLNTFQKFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPVIYA
FVGEKFRNYLSVFFRKHIVKRFCKHCSVFQQDNPDRVNSVYTRSTGEQDVSTGL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggatttgcaagagtcaacaacaacctttaactatgacaatgattatgatacatcagca
ccctgccaaaaaactgatgtgaaacaaattgcagcccagctcctgcctccactctactcc
ctggtattcatctttggttttgtaggtaacatgatggtcttcctcatcctaataagctgt
aaaaagctaaagaacatgactgatatctacctgttcaaccttgccatctctgacctgctc
ttcctgctcactctcccagtctgggctcactatgctgcaaatgagtgggtctttgggaat
ataatgtgtaaattattcacaggactctatcacattggttactttggtggaatcttcttc
attatcctcctgacaattgataggtacttggctattgttcatgctgtgtttgctttaaag
gccaggacagttccctttggggtgatgacaagtggcgtcacttgggtggtggtcatgttt
gcttctctcccagaaatagtatttaccagatctcaaaaagaaggttttcattatacgtgc
agtcctcattttccacacacccaatatcatttctggaagagtttccagacgttaaagatg
gtcatcttgagcctgatcctgcccctacttgtcatggtcatctgctactcaggaatcctc
cacaccctatttcgctgtaggaatgagaagaaaaggcacagggctgtgagactcatcttt
gccatcatgattgtctactttctcttctggactccctacaacattgtcctcctcctgaac
accttccagaaattctttggactgaataattgcagtagttctaatagactagaccaggcc
atgcaggtgacagagactcttggaatgacacactgctgcatcaaccctgtcatctacgcc
tttgttggggagaagttccggaattatctctcggtgttcttccgaaaacacattgtcaaa
cgcttttgcaaacactgctcagttttccagcaagacaatcctgatcgtgtaaactcagtc
tatacccggtccacaggagaacaggacgtttctactggtttatga

DBGET integrated database retrieval system