KEGG   Mucilaginibacter sp. PAMC 26640: A0256_01515Help
Entry
A0256_01515       CDS       T04335                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
mup  Mucilaginibacter sp. PAMC 26640
Pathway
mup00052  Galactose metabolism
mup00511  Other glycan degradation
mup00600  Sphingolipid metabolism
mup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mup00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A0256_01515
  Lipid metabolism
   00600 Sphingolipid metabolism
    A0256_01515
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A0256_01515
Enzymes [BR:mup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A0256_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C DUF4982 Glyco_hydro_2 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: AMR34392
UniProt: A0A142HZT4
LinkDB All DBs
Position
complement(329160..331556)
Genome map
AA seq 798 aa AA seqDB search
MSLAFVQVSYAQNGRTIADFDKGWKFHLGDVKNAEKTSADDKNWRKLNLPHDWSIEGTFS
KDNPATPEGGALPGGIGWYRKTFTVPLASKGKQVYIDFDGIYQHSDVWINGNHLGFRPNG
YISFEYDLTPYLNYGGINVIAVKADNSKQPNSRWYSGSGIYRNVWLVTTNKIAIDHWGTY
VTTPKVSAASATIALSTRIKNEADKQSYTIKVAIYDAAGKVASGGGAIPSAKQLDETSTT
LKSTFTLNKPILWSVERPYLYKIVTQVLSAGKVIDSYSTPLGIRSFSFDADKGFILNGKK
VKILGVCDHHDLGSLGSAINIRALERQLQILKGMGVNGIRTSHNPPAPELLDLCDKMGFI
VMDEAFDMWKMQKTKYDYHLYWDEWHKRDLEDQILRDRNHPSVFIWSIGNEIGEQYNRKD
TVGRVIARELAGIVRSLDDRPITAANNDPGIGSNLIASGALDLIGYNYHHQDYADFHKRY
PGKKFIGTETSSALETRGFYDMPSDSIRRWPASWDKVLDEKTGNSTQSVSAYDNVSAPWG
STHEETWKVVKKYDMLSGMYIWTGFDYLGEPTPYSWPSRSSYFGVIDLAGFPKDVYYMYK
SEWTKQSVLHIFPHWNWEAGKTVDIWAYYNNADEVELYLNGKSVGIKKKTGDDLHLMWRL
KFVPGTLKAVSRKNGKIVLTKEIYTAGAPAKIELSADRSNIKADGKDLSFITVRILDKSG
NVVPDADNLVKFKISGPATIASVDNGDPVSHDPFKADYRKAFHGLALAIVQGTEKAGTIT
FTATSAGLAPATVTIKVK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttggcgtttgtgcaagtaagttatgcgcaaaatggccgcacaatagccgatttc
gacaaaggctggaaatttcacctgggtgatgttaaaaacgccgaaaaaaccagcgccgac
gataaaaactggcgcaaattaaacctcccgcacgattggagtattgaaggcaccttcagc
aaggataaccccgctacgcccgaaggcggcgcactacctggtggcattggctggtaccgc
aaaacctttactgtgccgctggcatcaaaaggcaagcaagtttatatcgatttcgacggt
atataccagcacagcgatgtgtggataaatggaaaccatctcggcttccggccaaacggc
tatatctcttttgagtacgatcttaccccgtacctgaactatggcggcataaatgtgata
gctgttaaagcagataactcaaagcagcccaattcccgctggtattccggcagtggcatt
tatcgcaacgtttggctggtaaccactaataagatcgctatcgaccattggggcacttat
gtaactaccccaaaagtaagcgccgcatcggcaactattgcattaagcacacgcattaaa
aatgaagctgataaacaaagctacaccataaaagttgctatttacgatgccgccggtaaa
gtagcaagcggtggcggggctatcccgtcggctaaacagctggacgaaacaagcacgact
cttaaaagcacatttacgctgaataagcctatactctggtcggtagagcggccttatttg
tataaaatagttacgcaggtattaagtgccggcaaagtaatagattcctacagcacgccg
ctgggcatccgctctttttcgttcgatgcagataagggttttatcctgaatggcaagaag
gtaaagattttaggcgtatgtgatcaccacgacttgggcagcctgggctcggccatcaac
atccgcgctttggaaaggcagctgcaaattcttaaaggcatgggtgttaatggcatccgt
acctcgcacaacccaccagcgcccgaactgctggacctgtgcgacaaaatgggtttcata
gttatggatgaagcctttgacatgtggaaaatgcaaaaaaccaaatatgattaccacctg
tactgggatgaatggcacaaacgcgacctggaagatcagatcttgcgcgacaggaaccat
ccatcggtatttatctggagcattggaaacgaaataggcgaacagtacaatcgaaaagat
actgttggccgcgtaattgcccgcgaactggcaggtattgtgcgtagtttagatgaccgc
cccattactgcagcgaacaacgacccgggaatcggcagcaatctgatcgcctccggcgct
ttggatctgatcggctataactatcatcaccaggattacgccgactttcacaaacgttac
cctggcaaaaagttcataggtaccgagaccagctccgccttagaaaccagggggttttac
gatatgccgtcagacagcatccgccggtggccggcaagctgggataaagtgctggatgaa
aagactggcaactcaacccagtcggtttcagcttatgataacgtatctgcaccctggggt
tccacacatgaggaaacctggaaggtggtaaagaagtatgatatgctatccgggatgtac
atttggaccggctttgattatctgggcgaacctacgccgtacagctggccgtcgcgcagt
tcatactttggtgtgattgatctggcgggcttcccgaaggatgtttattatatgtataaa
agcgagtggactaaacaatctgtattgcatatcttcccgcattggaattgggaggcgggc
aaaacggtagatatttgggcttactacaataacgctgatgaagtggaactgtacctgaac
ggtaaatcagtgggcatcaaaaagaaaacaggtgacgaccttcacttaatgtggcggctg
aaatttgtgccaggcacgttgaaagcagtctcccgtaaaaatggaaaaatagttctgaca
aaggagatttacacagcaggcgcacctgctaaaatagaactatcggcagaccgaagcaat
attaaggcagatggcaaggatctatcattcattaccgtacgcatcctggacaaatccggg
aatgtagtgcctgatgcagataacctggtgaaatttaagatcagcggcccggctaccatt
gccagcgtcgacaacggtgacccggtaagccacgatccgttcaaggcagattatcgtaag
gcattccacggactggcgctggcgattgtacaggggacggaaaaagcggggacgataact
ttcacggcaacatcggcaggattggctcctgctacggtgacgattaaggttaagtag

DBGET integrated database retrieval system