KEGG   Mucilaginibacter sp. PAMC 26640: A0256_04020Help
Entry
A0256_04020       CDS       T04335                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mup  Mucilaginibacter sp. PAMC 26640
Pathway
mup00010  Glycolysis / Gluconeogenesis
mup00020  Citrate cycle (TCA cycle)
mup00620  Pyruvate metabolism
mup01100  Metabolic pathways
mup01110  Biosynthesis of secondary metabolites
mup01120  Microbial metabolism in diverse environments
mup01130  Biosynthesis of antibiotics
mup01200  Carbon metabolism
Module
mup_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0256_04020
   00020 Citrate cycle (TCA cycle)
    A0256_04020
   00620 Pyruvate metabolism
    A0256_04020
Enzymes [BR:mup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A0256_04020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AMR30650
UniProt: A0A142HP42
LinkDB All DBs
Position
921935..923653
Genome map
AA seq 572 aa AA seqDB search
MAEVVKMPKMSDTMTEGVLAKWHKKVGDKVKSGDVLAEIETDKATMDFESYQDGTLLYIG
VEEGNAVPVDAVIAVLGKEGEDYKALLDGGATTAAPAAEEKAPEAAPAAKEETKPAAAED
KKPAAPVEAKPKVDLSSIPAAVIRMPLLSDTMTEGTIEKWYFKVGDKVKADDSLADVATD
KATMEVVGYEEGTLLYIGVKEGEAAAVNGIIAIVGKEGTDITPLLQDTGSEAAPESSDSS
EKPANAESPETAAATSETGTSSTEDDSRVKASPLARKIAKDKGINLNDVKGSADGGRIIK
KDIESFTPAAAKPASAPATAPQEQAAAQPAAAPAKAAVVLPTYTGEEKFSERPVTQMRKA
ISRRLSESLFTAPHFYVTMSIDMDQAMAARVKMNDVAPVKISFNDFVVKACAVALKQHPV
INSSFLGDKIRTNEHVHIGVAVAVDEGLLVPVIKYADGKSLSHISQEVKEFAGKAKGKKL
QPAEMEGSTFTISNLGMFGVDEFTAIINTPNACILAVSGIQAVPVVKNGAVVPGNIMKVT
LSADHRVVDGASAAAFLQTLKSMLEEPVRMMI
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagttaaaatgcctaagatgagcgataccatgaccgaaggggtattggca
aaatggcataaaaaagttggcgacaaggtaaaatctggcgatgttttggccgagattgaa
accgacaaagccactatggattttgaatcgtaccaggacggcaccttgttatatataggt
gtagaagagggaaacgccgtacctgttgatgctgttatagcagttttaggtaaagaaggc
gaagactacaaagcacttttagatggcggtgctaccacggcagcacctgctgcagaagaa
aaggcacctgaagctgcacctgctgcaaaggaagaaacaaaacctgccgctgctgaagat
aaaaaacctgcggctccggttgaggccaaaccaaaggttgatctatccagcatcccggct
gcggtgatccggatgcctttgctaagcgataccatgactgaaggcaccattgaaaaatgg
tactttaaggtaggtgataaagttaaagcggatgattcattagcggatgtggcaaccgat
aaggctaccatggaagttgttgggtacgaagaaggtactttattatatataggcgtaaaa
gaaggcgaagccgctgctgtaaacggcattattgccattgttggaaaagagggtaccgat
attaccccgttattacaggataccggtagtgaagcagcaccagaaagcagcgatagcagc
gagaaacctgcgaatgctgaatctccagaaactgcagctgccaccagcgaaaccggcaca
tcttctaccgaagatgacagccgcgtgaaggcatccccgttagcgcgcaaaattgcaaaa
gataaaggcattaaccttaatgatgtaaaaggcagcgctgatggcggccgcattattaag
aaagatattgaaagctttacaccagctgctgctaaaccggcttcagcaccggccactgcg
ccgcaagaacaagctgccgcgcaaccagcggctgccccggccaaagcagcagttgtattg
ccaacttacaccggcgaagagaaattcagcgagcgcccggttacgcagatgcgtaaagcc
atcagccgcaggttatccgaaagtttatttactgctcctcacttctacgttaccatgtca
attgatatggaccaggcgatggccgcacgtgttaaaatgaacgacgttgcgccggttaag
atctcctttaacgattttgtggttaaagcatgtgcagttgcattaaaacagcaccctgtt
atcaattcatcattccttggtgataagatccgcactaacgagcatgtacacattggcgta
gccgtagcggttgacgaaggtttattggtaccggttattaaatatgctgatggcaaatcg
ttgagccacatttcacaggaagtaaaagaatttgcaggtaaagctaaaggtaaaaaatta
cagccggcagaaatggaaggctctacattcaccatatccaacctgggcatgttcggtgta
gacgaatttaccgccattatcaacacgccaaatgcatgtatccttgctgttagcggcatc
caggcagttccggttgttaagaacggtgcagttgtaccgggcaatatcatgaaggtaaca
ctaagtgcagatcaccgcgtggtagatggcgcatcagctgcagcattcctccaaacatta
aaatcaatgctggaagaaccggtaaggatgatgatataa

DBGET integrated database retrieval system