KEGG   Mucilaginibacter sp. PAMC 26640: A0256_05625Help
Entry
A0256_05625       CDS       T04335                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mup  Mucilaginibacter sp. PAMC 26640
Pathway
mup03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mup00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A0256_05625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mup03400]
    A0256_05625
Enzymes [BR:mup01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A0256_05625
DNA repair and recombination proteins [BR:mup03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A0256_05625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AMR30941
UniProt: A0A142HPY3
LinkDB All DBs
Position
complement(1314069..1316813)
Genome map
AA seq 914 aa AA seqDB search
MSLEKYAEKRDFTKTAEPKGGKSPEKDKLRFVIQKHDASRLHYDFRLEMDGVLKSWAVPK
GPSTDPKNKRLAMMVEDHPYDYRLFEGIIPQGEYGGGTVIVWDEGTYEPIEEIKGKKAQE
KHLLKQLKDGSLKIKLHGEKLEGEYALVKTHGMGENGWLLIKHKDDFASAADITKKDKSV
LTGKTIEKMEKTSEKVWQHGHEEDVDDTKTNSKKKAGKIKPQVEAIEDVIEEAKPAEKVD
VEAVLKKAPKGAIPTGMKPMLATLVDKPFDDPDWLYEIKWDGYRALGFINKGEVQLLSRN
NKSFNEKYYPITQLLESWKINAVIDGEILVLNDKGVSNFGALQNWRSEADGELMLYVFDI
LWYDGKNLMDLPLTQRQAILKEVLPTNDDRIRMSQVFTASGIEFFEAAEKIGLEGIMAKK
ADSTYSADNRSKDWLKIKINKRQEVVIGGFTKNEGTAKQFSSLLLGVYEGGRFQYVGKVG
TGFSDKLQKEMMASFKPLIVDKTPFDTEPDVNKPSRFRPNPPKAKATWLKPELVCEVSFT
EVTSDGVFRHPSFQGMRDDKKAKDVVRETEVDTDELVADEVPEKAAKPKEHKHRLVKAPK
ESAKRTLLNPKEETQVKKICGHDLKFTNLSKVYWPEDGITKRDMFNYYYQVAEYILPYLK
DRPQSLNRFPGGIHGPSFYQKDVKGKSPDWVRTFPYTTSDGEEKDYLVGHDEATLLWMAS
LGCIEMNPWFSRVQSPDNPDYCIIDLDPDKNTFDQVISAALEVKKVLDAIDVPCYCKTSG
STGMHIYIPLGAKYDYDQSQMFARLIVNIVHKEIPEYTSLERMIKNRDGKMYLDFLQNRP
GATIAGPYSLRPKPGATVSMPLHWDEVKPGLTMKDFTIHNAIARLKKEGDLFKGVLDEGI
DLEKTITKAKSIFK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggaaaaatatgcagagaagcgggactttactaaaaccgcagaacccaagggt
ggtaaaagtcccgagaaggataaattgcgcttcgtgatccaaaagcacgacgcaagccgt
ttgcattatgatttcaggctggagatggatggcgtgcttaagagctgggcggtacctaag
ggcccatccaccgaccccaaaaacaaacggctggctatgatggtggaagatcacccgtat
gactatcgcttgtttgaaggtattatccctcagggcgaatatggcggcggtacggtgatt
gtttgggatgaaggcacctacgagcctattgaggaaattaagggcaagaaagcacaagaa
aagcatctgctcaagcaactaaaagatggctccctcaaaataaaactccacggggaaaaa
ttagagggcgagtacgcgctggtaaaaacccatggcatgggcgagaatggctggctgctg
atcaagcataaagacgattttgcgtcggctgccgacattaccaaaaaagataaatcggta
cttaccggtaaaaccattgaaaagatggaaaaaaccagtgagaaggtttggcagcacggc
cacgaggaagatgtggacgatacaaagactaatagtaaaaaaaaagcaggtaaaataaaa
cctcaggttgaagcaatagaagacgtaattgaagaagcaaaacccgcagagaaagttgat
gttgaagccgtattaaaaaaggcacccaaaggcgctatccctacaggaatgaaacccatg
ctggctacattggttgataaaccatttgatgaccccgactggctctacgaaataaaatgg
gatggttaccgtgcacttggctttattaacaaaggcgaagtacaattgctctcccgtaat
aataagtcgttcaacgaaaaatattaccccattacccagctattggaaagctggaagatc
aacgctgtgatagatggtgaaattttggtgctgaacgacaaaggcgtatctaactttggt
gcactgcaaaactggcgaagtgaagcagacggcgaattgatgctgtacgtattcgatata
ttgtggtatgatggtaaaaacctgatggacctgcctcttacacaacggcaggctattctg
aaagaagtgctaccaactaacgatgaccgaatccgaatgagccaggtgtttacggccagc
ggaattgagttttttgaagctgctgaaaagattggtttggaaggtattatggcaaagaaa
gccgatagtacttatagcgccgataatcgttccaaagactggctgaagatcaagattaac
aaacgccaggaagtggtgattggtggttttacaaaaaatgaaggcacagccaagcaattt
agctcactgctgttaggcgtttatgaaggtggccgctttcagtatgtaggcaaggttggc
accggcttttctgataagctgcaaaaggaaatgatggcatcatttaagccgttaattgtt
gataaaacgccatttgacaccgagccggatgtaaacaagccatcgcgcttcaggcctaat
ccgccaaaggcgaaagctacctggttaaagccggagctggtttgcgaagtaagttttacg
gaagtaaccagcgacggtgtatttcgccacccctcttttcagggcatgcgggatgacaaa
aaagcgaaagatgttgttcgggaaacggaagtggataccgatgagttagtagcagatgaa
gtgccggaaaaagcagcaaagccaaaagagcataaacaccgcttagttaaagcgccaaaa
gaatcggcaaagcgtacgctgcttaatcctaaggaagaaacgcaggttaaaaagatctgc
gggcacgatctgaaatttactaacctcagcaaagtatactggcccgaggatggcatcacc
aagcgggatatgttcaattactattaccaggtagccgagtatattttaccatatttgaaa
gaccggccgcaatcgctcaaccgtttcccggggggcattcacgggccgagtttttaccag
aaggatgtaaaaggcaaatcgccggattgggtgcgcactttcccttatactaccagcgat
ggcgaagaaaaggactaccttgtggggcacgatgaagctaccctgctgtggatggcatca
ttgggatgtattgaaatgaacccctggtttagccgtgtgcagtcgcccgataatccggac
tattgcatcatcgacctcgacccggataaaaacaccttcgaccaggtgatctcggccgct
ttagaggtaaaaaaagtattggatgccatcgatgtgccttgctattgcaaaacatccgga
tccaccgggatgcatatttatatcccgctcggtgcaaaatacgactatgaccagtcgcaa
atgtttgcccggttaatcgtaaacattgttcacaaggaaattccggagtatacttccctg
gagaggatgattaaaaaccgggacggcaaaatgtacctcgattttctgcaaaaccgcccg
ggcgcaaccattgcgggcccatattcgctacggccaaagccaggcgcaacggtatctatg
cctttgcattgggacgaagtaaagccgggcttaacgatgaaagattttaccattcataac
gctatagcgcggctcaaaaaagaaggcgacttgtttaaaggcgtactggatgaaggaata
gacctggagaaaacgataacgaaagcgaaaagtatattcaagtaa

DBGET integrated database retrieval system