KEGG   Mucilaginibacter sp. PAMC 26640: A0256_06995Help
Entry
A0256_06995       CDS       T04335                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mup  Mucilaginibacter sp. PAMC 26640
Brite
Enzymes [BR:mup01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A0256_06995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMR31188
UniProt: A0A142HQN0
LinkDB All DBs
Position
1615174..1615785
Genome map
AA seq 203 aa AA seqDB search
MAFTLPALSYATDALEPHIDKATMEIHHGKHHQAYVTNLNKALEGKPEADAKIEDIIKNI
SKFPPAVRNNGGGHYNHTMFWTLLSPSGGGEPTGALADAIKSTFGSFADFKTKVSEAGAT
RFGSGWAWLIVTADKKLAVTSTPNQDNPLMDIAEVKGTPILGIDVWEHAYYLKYQNRRPD
YLAAIWNVINWAHVSELYTKAIA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacactaccggcgttatcttacgctactgatgcattagaaccgcatattgat
aaagctactatggaaattcaccatggcaagcaccaccaggcttatgttaccaacttaaac
aaagctttggaaggtaaaccagaagcagatgcgaaaatcgaagacatcattaaaaacatc
tctaagtttccgcctgctgtacgtaataatggtggtggtcactataaccacactatgttc
tggactttgttatctccaagcggtggtggcgagccaacaggcgcattagccgatgcgatc
aaaagcacgttcggttcatttgctgatttcaaaactaaagtatctgaagctggtgcaacc
cgtttcggttcgggctgggcatggttaattgttactgctgataaaaaactggctgtaact
tcaacccctaaccaggataaccctctaatggatattgctgaagtaaaaggcacaccgatt
ttaggtattgatgtttgggaacatgcttactacttaaaataccaaaaccgtcgccctgat
tatttggcggctatctggaatgtaattaactgggcacacgtgtctgagttatacactaaa
gcaatcgcttaa

DBGET integrated database retrieval system