KEGG   Mucilaginibacter sp. PAMC 26640: A0256_17260Help
Entry
A0256_17260       CDS       T04335                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mup  Mucilaginibacter sp. PAMC 26640
Pathway
mup00473  D-Alanine metabolism
mup01100  Metabolic pathways
mup01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mup00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0256_17260
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A0256_17260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mup01011]
    A0256_17260
Enzymes [BR:mup01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A0256_17260
Peptidoglycan biosynthesis and degradation proteins [BR:mup01011]
 Precursor biosynthesis
  Racemase
   A0256_17260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AMR34600
UniProt: A0A142I0E2
LinkDB All DBs
Position
complement(3985916..3988378)
Genome map
AA seq 820 aa AA seqDB search
MQGSYPISEIKEIINAAGDVVNNSQVSILLTDSRRIINPAASLFFALSNRRDGHQFIIDT
YTAGVRSFVVEHQPELIMPDANFLVVDNVLAALQRLAANHRSRFNLDVIGITGSNGKTIV
KEWLYQLFCPEKNIVRNPKSYNSQIGVPLSVWAINDSQNLGIFEAGISTSGEMEKLEAVI
QPTIGVLTHMGTAHDEGFPSPEAKLEEKLKLFKDCRLLICNYEILQARHEVIKAGETFTW
SRKFKPADLYVFSETTISGKYYLRAMYREQEIECLIPFRDEASIENAIVCWATMLAMGYS
PADADDRLERLTAVSMRLELKHGINDCSVIDDSYNSDIQSLEIALNFLTQQNQHQKKTLI
LSDIYQSGLEQEALYRQVAQLIADKKVQRLVGVGPALKAHQHYFIAPEKHFYNDTNALLK
DLGKLHFRKETILIKGSRSFEFERISRALVQKAHETVLEINLNKLLSNLNYYKSKLHPGV
KLMAMVKAFSYGSGTFEVANILEYNKVDYLAVAYTDEGIALRENGITLPIVVLNPEPLAY
DRLVANQLEPEIYSFTLLDEFVKYAQEAEISNYPIHIKIDTGMHRLGFEDFEIETLCDML
EINPYVKVMSVFSHLVASDSEAHDLFTLKQIGLFEKAFAQIEEAIGYQVIKHISNTSGIT
RWPTAQYDMVRLGIGLYGVDGAVPADDTSLQPIATLKTTVSQVKKVLANDTIGYNRNGSL
KRDGYIATVRIGYADGYIRAFGNGVGRMLINGVPVPTVGNVSMDMCMLDVTEVPGIKEGD
EVIVFNDQQRIEQLAAQAGTIPYEILTNISQRVKRVYFYE
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggttcctatcccataagtgaaattaaggagatcattaacgccgccggcgatgtg
gtaaataatagccaggtgagcattttgctgaccgatagccgccgcatcatcaaccccgct
gcatctttgttttttgcattgagtaaccggcgcgacgggcaccagttcattatagatact
tataccgctggcgtgcgcagctttgtagttgagcaccagccggaactcatcatgcccgat
gctaatttcctggtagttgataatgtattagcagccctgcagcgtttggcggccaatcac
aggagccggtttaatctggatgtgattggcattaccggcagcaacggtaaaaccattgtg
aaggaatggctttaccagcttttttgccccgaaaaaaatattgtccgtaatcctaagagt
tataattcgcaaataggggttccgctctctgtttgggccataaacgatagtcaaaacctc
ggtatttttgaagccgggatctccacctcaggtgaaatggaaaagctggaggcggttatt
cagcccaccataggtgttttaacccacatgggcactgcacacgatgagggtttcccatcg
ccggaggctaaactggaggagaagctaaagctttttaaagactgccgcctgctcatctgt
aattacgagatcctgcaggcccggcacgaggttataaaagccggcgaaacctttacctgg
agccgcaaatttaaaccggccgatctctatgtgttcagtgaaaccacgatctccggcaaa
tattatctccgcgccatgtaccgggaacaggaaattgaatgcctgatcccgtttagggat
gaagcctccatagagaacgcgattgtttgctgggccactatgctggccatgggctattcg
cctgcggatgccgacgaccggctggaacgccttaccgccgtaagcatgcggctggagctt
aaacacggcatcaacgattgctcggtgatcgacgattcctataactcggatatccagtcg
ctggagattgccctcaactttttaacccagcaaaaccagcatcagaagaaaacccttatc
ctgtcggatatctaccagtccggattggagcaggaggccctgtaccggcaggtggcccag
ctcattgccgataaaaaggtacagcgcctggtaggagtaggcccggcgcttaaggcgcat
caacattattttatcgcaccggaaaaacatttttataatgataccaatgccttattaaaa
gacctgggtaaactgcatttcagaaaagaaaccatcctcattaaaggttcgcgcagtttt
gaattcgagcggatcagccgggcactggtgcaaaaggcacatgaaaccgtactggagatc
aacctcaataaattactgagcaacctcaactattataaatccaaactacaccccggcgta
aagttgatggcgatggtaaaggcattctcctacggcagcggcacgttcgaggtggccaat
atattagagtataacaaggtagattacctggccgtagcgtatacagatgaagggattgcc
ctgcgcgaaaacggcattacgctgcccattgtggtgctgaaccccgaaccgctggcctac
gaccggctggtggccaaccagctggagccagagatctatagttttaccctgctggatgag
tttgtgaaatatgctcaggaggcggagatcagcaattaccctatccatattaagatagac
acgggcatgcatcgcctgggttttgaggattttgagatagaaaccctttgcgatatgctg
gagattaacccgtatgtaaaggtgatgtcggtattttcgcacctggtagccagcgactcg
gaagcacatgatctgttcacgctcaaacaaattggtttgttcgaaaaagcttttgcacag
atagaagaagcgatcgggtatcaggtgatcaagcatatcagcaatacatcgggcattacc
cgctggcccacagcgcagtatgacatggtaaggctcggcattggtttgtatggggtagat
ggggcggtaccggcggatgataccagtttgcagcccatcgccacgttaaaaaccaccgta
tcgcaagtgaaaaaagtactggctaacgataccattggctataaccgcaacggtagctta
aaacgcgacggctatatcgccacagtacgcattggctatgcagatggctacatccgcgcc
tttggcaatggtgtgggccgcatgctgatcaatggcgtgccggtacccacggtaggtaac
gtatcaatggatatgtgtatgctggatgtaaccgaagtacccggcataaaagaaggcgac
gaagtaattgtatttaacgaccagcaacgcatagaacaattggccgcccaggcaggcaca
ataccctatgaaatattgaccaatatttcccaaagggtgaaaagggtttatttttatgaa
tag

DBGET integrated database retrieval system