KEGG   Mucilaginibacter sp. PAMC 26640: A0256_18795Help
Entry
A0256_18795       CDS       T04335                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
mup  Mucilaginibacter sp. PAMC 26640
Pathway
mup00380  Tryptophan metabolism
mup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    A0256_18795
Enzymes [BR:mup01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     A0256_18795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMR33320
UniProt: A0A142HWR2
LinkDB All DBs
Position
complement(4353472..4354764)
Genome map
AA seq 430 aa AA seqDB search
MIYQSTLSFAAEQDERDELKLFRSQFHIPKHKGVDAIYLCGNSLGLQPISARKYLQDQLD
AWQANAVEGWFVGDDPWLSYHKQLIPTLADIIGARTDEITIMNSLTVNLHLLMVSFYKPT
SKRFKILMEAGAFPSDQYAMESQVKFHGYDPGEAIVEVYPREGEVTLRTEDIIQKIRENA
GELALVMFSGINYFTGQLFDMAAIAKAAHGAGAFAGFDLAHAAGNVPLNMHDWDADFACW
CSYKYMNSGPGGISGVFVHDKHFGDTGLDRFAGWWGYRNDKRFLMAQGFEPEAGAEGWNV
STAPIMLLALHKASLDIFDNAGGLKLLRAKSEALTGYLEFLINEINEKMEDEVYRIITPK
NKAERGCQLSIVCKNNAKDIFNYLAENGVIGDWREPNVIRLSAVPLYNTFTNVFNAAQYL
FKALDAVIKE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccagtcaactttaagttttgcagcagaacaggacgaaagggatgagcttaaa
ctgtttcgttcccagttccatattcctaaacacaaaggtgtggatgccatttacctttgc
ggaaactccttaggcttacagcccatttctgccaggaagtatctgcaggatcaactggat
gcctggcaggctaatgctgtagaaggctggtttgtgggagatgacccctggttatcctac
cataagcagcttatccctacgcttgcggatattataggtgcccgaacggatgagatcacc
atcatgaattcgcttacagtgaatcttcacctgttgatggtaagcttctataaaccaacg
agtaaaagatttaagatcctgatggaagctggtgcatttccttcagatcaatacgcaatg
gaaagccaggtaaagtttcatggatacgatccaggcgaggctattgtggaagtgtatccg
cgtgagggagaggtaactttacgtaccgaagatattattcaaaagatccgggagaatgct
ggtgagctggcgctggtgatgtttagcggaataaactactttaccggccagctgtttgat
atggcagctatcgccaaagcagcccacggggccggagcttttgctggtttcgacctggca
catgcagcaggcaatgtacctcttaacatgcatgattgggatgccgattttgcttgctgg
tgctcctacaaatacatgaattctggtccgggcggtatcagcggtgtgtttgtgcatgac
aaacattttggagataccggccttgatcgctttgccggctggtgggggtatcgaaatgat
aaacggtttttgatggcacaagggttcgagccggaagcgggcgctgagggctggaacgta
agcacagcgccaatcatgctgctggcactacacaaagcatcactggatatttttgataat
gcaggggggcttaagctgcttcgtgcaaaaagcgaagctttaactggttatctcgagttt
ttgatcaatgagatcaacgaaaaaatggaagatgaggtgtaccggatcattaccccaaaa
aacaaagctgagcgtggctgccagttatctatagtttgtaagaataatgcaaaagacata
tttaattacctggctgaaaatggggttattggcgactggcgggagccgaatgtgatccgc
ctgagtgctgtgccgttatataatacctttacgaatgtttttaatgccgcacaatacctt
tttaaagcccttgatgctgttataaaagaataa

DBGET integrated database retrieval system