KEGG   Musa acuminata (wild Malaysian banana): 103971678Help
Entry
103971678         CDS       T03447                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00564  Glycerophospholipid metabolism
mus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103971678
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103971678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 FAD_binding_3 HI0933_like Pyr_redox NAD_binding_8 Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 103971678
NCBI-ProteinID: XP_009384036
LinkDB All DBs
Position
11
AA seq 631 aa AA seqDB search
MATASRLRGLGAVLAASGATWAAVSLVQPPASASDRGPAGLDAARRRIADPAAAIPPREV
QESALIGTSVINPLDVLVIGGGATGCGAALDAATRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLVFHALRERKQVIENAPHLCQALPCMTPCFEWFEAVYYWMG
LKLYDLVAGRRMLHLSRYYSANESVELFPTLSRKGHNGSLKGTVVYYDGQMNDSRLNVGL
ACSAVLVGATVLNHAEVISLIKDDFGERIIGARIRDQLSGKEFDAYAKVVVNAAGPFCDS
VRKMANKDLSAMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTIAGTTD
SNTAITMLPEPHEDEIQFILDAICSYLNVQVRRSDVLSAWSGIRPLAMDPSAKNTESISR
DHIVLEDYPGLITITGGKWTTYRSMAEDAVDAAIRSGKLNPANGCVTDNLHLVGGYGWDP
ASFTFLAQHYVRMKRTHSGKVIPGVMDSAISKHLSHAYGTLAEQVAAIAQNENLGKRLAH
GYPFLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAACRALPRVIQILAAEHKWDRAR
QKLELQRAKEFLETFKSSKNAQFHDGKHIGS
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgcttctcgattgagagggctgggtgccgtcctcgccgcctcgggcgcgacc
tgggcggcggtctcactcgtgcagccgccggcctccgccagcgaccgcggccccgcaggg
ctcgacgccgctcggcggaggatcgccgatcccgccgccgcgatcccgccgagggaggtc
caggagtcggccctgatagggaccagcgtcatcaacccactcgatgtcctcgtgattggc
ggcggggccaccgggtgcggcgccgcgctcgatgccgccacccgtgggctccgcgtcggc
ctcgtcgagagggaggatttctcgtcggggacttcttcgaggtctactaaactgatccat
ggcggtgtacgatatctggaaaaagctgtgtttaatcttgattatgggcagttgaagctt
gttttccatgcactaagggagcgtaaacaggtcattgagaatgccccacacttgtgtcaa
gctttaccatgcatgacaccttgttttgaatggtttgaggctgtatattattggatggga
ctgaaattatatgatctcgttgctggtcgaaggatgctacatctctcacgatattattct
gcaaatgagtcagttgaactttttccaactctgtctaggaagggtcacaatgggagcttg
aagggaacagttgtttattatgatggacaaatgaatgactcccggctgaatgtaggactg
gcctgtagtgctgtattggtgggtgcaacagtgcttaaccatgcagaagtgatatctttg
atcaaggatgattttggtgagcggataattggcgcacgcatccgtgaccagttatcaggg
aaagagttcgatgcatatgcaaaagttgttgtaaatgcggctggaccattctgtgatagt
gttagaaaaatggccaacaaagatttatcagcaatgatttgtccaagtagtggtgtccat
atagtgcttcctgattattattctcctgagggaatggggctaattgttccaaaaactaaa
gatggccgtgttgtttttatgttgccctggttgggaaggacgattgctggaactacagac
tccaacactgccattacaatgctcccagagccacatgaagatgaaatacagttcatattg
gatgccatttgtagctatcttaatgttcaggtgagacgttcagatgtgctttctgcttgg
agtggtatacggccgttggccatggatccatctgcaaaaaacactgagagtatatccaga
gatcatattgtccttgaagattatcctggtttaatcacaattactggtggaaagtggact
acttatcgaagcatggctgaagatgctgttgatgctgctataaggtcaggcaagctgaac
cctgctaatggttgtgtgactgacaacctgcaccttgttggtggatatggttgggatcct
gcatcattcacttttcttgctcagcactatgtccgcatgaaaagaacacatagtggaaaa
gttattcctggggtgatggatagtgctatttcgaagcatttatctcatgcatatggtact
ttggctgaacaagtggctgctattgctcagaatgagaatttagggaagcggcttgcccat
ggttacccctttctggaggctgaggttgcatattgtgctcgtaatgagtactgcgagtcg
gccgtcgacttcattgctcggagatctcgccttgcatttcttgacactgatgcagcatgc
cgggcattgcctcgtgtaattcagattttggctgctgagcacaagtgggacagggccaga
cagaagctcgagctgcagagggccaaggaatttttagaaacatttaaatcatcaaagaat
gcacagttccatgatggaaaacacatagggtcatga

DBGET integrated database retrieval system