KEGG   Musa acuminata (wild Malaysian banana): 103972433Help
Entry
103972433         CDS       T03447                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00052  Galactose metabolism
mus00500  Starch and sucrose metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103972433
   00500 Starch and sucrose metabolism
    103972433
Enzymes [BR:mus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103972433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103972433
NCBI-ProteinID: XP_009385048
LinkDB All DBs
Position
11
AA seq 889 aa AA seqDB search
MRARIVSCSVASFPCFFFLLVLFFSCSASQEQQVVGHGYDLRSVGVDPSGKTLTAELGLI
QETSVYGADIPKLGLLASFETNDRLRVRITDSDHERWEIPQHIIPREPQASLRSMLEADR
SQSPPENHVLSSSDSDVVFTLHGTSPFTFTVSRRSTGDILFDTLPTVVFKDSYLETSSSL
PADRASIYGLGEHTKKSLKLVPDDTFTLWNSDIPASIPDLNLYGSHPFYIDVRSSSPDTT
YPPGITHGVLLLNSNGMDVIYGGSYITYKVIGGVLDFYFFAGPSPLSVMDQYTELIGRPA
PMPYWSLGFHQCKYGYKNVFELEEVVGGYAKASIPLEVMWTDIDYMDAFKDFTLDPINFP
ADRMNEFVDKLHENGQKYVVIIDPGISVNYTYDTFVRGMEQDVFLKRGGSNYLGNVWPGP
VYFPDFLNPAAAKFWAQEIDIFRKTLPVDGLWVDMNEISNFITSPPLNSLDDPPYSINNA
GVRRPINTKTVPASATHYGNVSEYNAHNLYGFLESRATHDGLIGSTGKRPFVLSRSTFVG
SGKYAAHWTGDNVATWEDLGYSIPSILNSGLFGIPMVGADICGFGGDTTEELCRRWIQLG
AFYPFSRDHSAIMTSPQELYVWDSVALSARKVLGLRYRLLPHIYTLMYEAHVKGAPIARP
VFFSFPEDATTYNISTQFLIGAGVMVSPVLKPGAVEVDAYFPKGKWFNLFNYSQSVTSNS
GQYVTLDAPQDAINVHVGGGSVLAMQGEALTTQSARQSPFELLVVLDEDGTAAGEVFLDD
GETVEMAGEESEWSLVRFSAETEGKGPKLRSQVVNGAYASKHRLVLNKVVILGMELKETS
KVSVKSLGAGNTSEATVAHQKNGRFSVVEIKSLSLLMGEEFELQIEVEA
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaggatagtctcctgctctgttgctagcttcccctgcttcttcttcctcctc
gtcttgttcttttcttgctccgcttcgcaagagcaacaagtcgttggacacgggtacgat
ctccgatcggtaggcgtcgatccttccgggaagacgttgaccgctgagctcgggctgatt
caggagacgtcggtttatggagccgacattccaaagctcggtctcttggccagctttgag
accaacgatcggctacgagtccgaatcaccgactccgaccacgaaagatgggaaatccct
cagcacatcatccctcgcgagccacaggcatctctccgctccatgctggaagccgaccgg
tctcagtctccgccggagaatcatgtcctctctagctcagactccgacgtcgtcttcacc
ctccatggaacgtccccttttacgttcaccgtctcccgccgctccacgggcgacatcctc
ttcgatacgctccccacggttgtcttcaaggacagttacctggagacctcgtcgtcgctt
ccggcggacagagcatcgatctatggactcggggagcacaccaagaagtcgttgaagcta
gtcccagatgacacgtttaccctgtggaattcagatatccctgcgtcaattcctgatctg
aatctgtatgggtctcatccgttctacatcgacgtcagatcatcgtctcccgacacgacg
tatccgccggggatcacccacggagtgctcctcctgaacagcaacgggatggacgtcata
tacggaggatcttacatcacctacaaagtgattggaggagtactcgacttctactttttt
gcagggccatcgccattgtcggtgatggaccagtacaccgagctcatcggccggccggct
ccgatgccgtattggtcgcttgggttccaccagtgcaaatacggctacaaaaacgtgttc
gagcttgaagaggtggttggagggtatgccaaggccagcataccgctggaggtaatgtgg
accgacatcgactacatggacgcattcaaagatttcactctcgatcccatcaacttccca
gcggataggatgaatgaattcgtcgacaagcttcacgagaatgggcagaagtatgtcgtc
ataatagatccaggtatcagcgtcaactacacatacgatacgtttgtgagagggatggaa
caagatgtcttcttgaagagaggcggaagcaactaccttggtaatgtctggcccggacca
gtctacttcccggacttcctcaacccagcggctgctaaattctgggctcaagagatcgac
atctttaggaagacgcttccggtggacggcctgtgggtcgacatgaatgagatatccaac
ttcattacctctccgccgctgaattcgctggatgatcctccttacagcatcaacaacgcc
ggcgtgcggcggcccatcaacaccaagacagtccccgcatctgcgactcactacgggaac
gtgtcggagtacaacgcccacaacctgtatggctttctggagtcgagggcgacccatgac
gggctcatcggatccacagggaagaggccgtttgtgctaagccggtcgaccttcgtgggt
tcggggaagtatgcagcgcactggaccggcgacaatgtcgcgacatgggaagatcttggg
tactctataccgtcgattctcaactctggtctgttcgggatccccatggtcggggcagac
atctgcggcttcggcggtgacaccactgaggagctgtgccggcggtggattcagttaggt
gcattctatccattctcgagggatcactcggccatcatgacgtctccacaagagctctac
gtctgggattccgtcgccctttccgcgagaaaggtgctcggactccggtaccgtcttctt
ccccatatctacaccttgatgtacgaggcacacgtcaagggcgcgcctatagcgcgacca
gtgttcttctcattccctgaagacgcaacgacctacaacatcagcacacagtttctgatc
ggagcaggagtgatggtttccccggtactgaagccgggggccgtcgaggtcgatgcatac
ttcccaaaaggcaagtggttcaacctattcaactactcacagtcggtgacgagcaactcc
ggccagtatgtaacgcttgacgccccgcaagacgccatcaacgttcacgtcggaggaggg
agcgtcttggcgatgcaaggcgaggccctgaccacacagtcggcgcggcagagtccgttc
gagctcctggtggtgctcgacgaggacggaaccgcggcaggggaggtgtttctggacgac
ggggagacggtggagatggcaggggaggagagcgagtggagcttggtgaggtttagtgcg
gagacagaagggaaaggcccgaagctacgatcacaagtggtcaacggcgcatacgcatcg
aagcacaggctggtattgaacaaggtggtgatccttggcatggagttgaaggaaacatct
aaagtatctgtgaaatcactgggagcgggcaatacctcagaggcaactgttgcacaccag
aaaaatgggaggtttagtgtggtagagataaagagcctgtctctgctcatgggtgaggag
ttcgagctacagatcgaggtcgaagcttag

DBGET integrated database retrieval system