KEGG   Musa acuminata (wild Malaysian banana): 103973483Help
Entry
103973483         CDS       T03447                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1 isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103973483
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mus03036]
    103973483
Enzymes [BR:mus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103973483
Chromosome and associated proteins [BR:mus03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103973483
   Polycomb group proteins
    PRC2-EZH2 complex
     103973483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 103973483
NCBI-ProteinID: XP_009386332
LinkDB All DBs
Position
Unknown
AA seq 923 aa AA seqDB search
MASNASSSASECKSEPSAEHQIVGVKEGNCTPSDVMEIIDSLKKQVFSDRCTYIKKKMDE
NKQKLSSMTQLVYNLSKVRRNSSDHNSDLDTNLLTRRQDDALCTVNSLEQSAGEKDSGSC
QEESSYASSTVLIGNNFGGKNGVRLIKLPEVPKLPPYTTWIFLDRNQIMTEDQSVVGRRR
IYYDQNCGEALICSDSEDDFVEDEEEKKEFGTHEDFIIRMTIERVGLSDVALDTLSQSLE
KNSVEIRARFENFLKQDSNEECVKNVEVEPNVRVDDAFLEKDLEAALDSFDNLFCRRCLV
FDCRLHGCSQDLVFPAEKQHPWTNSDDGDPCGIHCYKLASKSESTATANSQPHDLEEATH
SVGSPGSQLSPRRKIKGSTGRRAKSHQNESASSNAKVVSETSESDTRVNQDNVSAQLSSS
PTKNKQRGKCGTRKKTNKRVAERVLICIRKKQKKMMQSDADSIVSGCLVARDMKLRSDTR
KDNKNSSSSMINKIIKSSTIRNNRKKAIQHQDSMNSKYVEAQNDNIFQASMEPSATDGDE
SERKEEFVDENICKLVKTDSKPWKIIEQGLFLKGLEIFGRNSCLIARNLLSGMKTCVEVF
QYMNHIQDNATYRAADGAISLVEGHGKVSELRTRSRFLRRRGRVRRLKYTWKSAGYHSIR
KRITERKDQPCRQYNPCGCQSACGKQCRCLLNGTCCEKYCGCPKICKNRFRGCHCAKSQC
RSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQRQRVLLGR
SDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAY
RKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR
KPESSVSKKDESQPSSGRAKKLA
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaacgcctcgtcctccgcttccgagtgtaaatcggagccctcggcagaacat
cagatagttggagttaaagaaggaaattgtactccttcggatgttatggaaattatagat
tctttgaagaaacaagtcttttctgatcgttgcacttatatcaagaaaaaaatggatgag
aacaagcagaagctcagtagcatgacacaactggtttataatttatccaaggttagaaga
aatagttcagaccacaacagtgacttagacacaaatctcttaacaaggaggcaagatgat
gccctttgtacagtaaatagtcttgaacaatctgctggagaaaaggatagtggtagttgt
caagaagaaagttcatatgcatcctcaactgttcttatagggaacaattttggaggaaaa
aatggagttcgactgatcaaactccctgaagtgcccaaactacctccatatactacatgg
atatttttggacaggaaccaaataatgacagaggatcaatcagttgtgggtcgtagaaga
atttattatgatcaaaattgtggtgaggctttaatctgcagtgacagtgaagatgatttt
gttgaggatgaggaagagaagaaagagtttggaacacatgaagatttcattatccgaatg
actattgaacgagttggcctatctgatgtggctctagatacattgtctcaaagcctggag
aagaactctgttgaaatcagggcgagatttgagaactttcttaagcaagactctaatgaa
gagtgtgtaaaaaatgtggaagttgaacctaatgttagagtggatgatgcatttcttgaa
aaggatctggaggcagcattagattcttttgataaccttttttgccgccgttgtctggtt
tttgattgtagactgcacggatgttctcaggatctggtgtttcctgcagagaaacagcat
ccctggaccaactcagatgatggtgatccatgtggtattcattgctataaattggcttcc
aaatcagaaagtacagctactgcaaattctcagccccatgaccttgaagaggcaactcat
tcagttggtagtcctggatcacaattgtctccaagaagaaaaattaaaggttccacagga
aggagggcaaagtctcatcaaaatgaaagtgcgtcttcaaatgcaaaggttgtctctgag
actagtgagtctgacacacgtgtcaatcaggataatgtatctgctcaactctcttcctca
cctactaaaaataagcagcgtggaaaatgtggaaccaggaagaaaaccaataaaagagtt
gctgaacgtgttcttatttgcataaggaagaaacagaagaaaatgatgcagtcagatgct
gattcaattgttagtggatgccttgttgctcgagatatgaagctccgatcagatacacga
aaggacaataaaaattctagttcatcgatgataaacaaaataattaagtcttcaactata
agaaacaacaggaagaaggccatacagcatcaggacagtatgaactcaaaatatgttgaa
gctcaaaatgataatattttccaggcatcaatggagccttcagcaacagatggtgatgaa
agcgaaaggaaagaggagtttgttgatgagaacatctgcaaacttgtgaagacggatagt
aaaccatggaagattattgaacagggcctctttcttaaaggtttagagatttttggaagg
aacagttgtttgattgctagaaatcttttgagtggaatgaagacttgtgttgaagttttt
caatacatgaaccacattcaagataatgcaacatatagggcagctgatggtgctatttct
ctagttgaaggccatggcaaggtctctgagttacgaacaaggtcaaggttcttgcgaagg
cgaggaagggttcgtcgtttgaaatacacgtggaaatcagctgggtaccattcaatacgg
aaaagaattactgagaggaaagatcagccttgtcggcagtacaacccttgtggttgccag
tctgcttgtggaaagcaatgtcgttgccttctaaatgggacatgctgtgaaaaatattgt
ggatgtcctaaaatatgtaaaaaccggttccgaggttgtcattgtgctaagagtcaatgc
cgcagccgtcaatgcccatgttttgctgctgatagagaatgtgacccagatgtttgtaga
aattgttgggttggttgtggtgatggtacattaggaggccctaatcaaagaggagataac
tatgaatgtcgcaatatgaagcttctactaaaacaacgccaaagggtcttacttggaaga
tctgatgtttctggttggggggcatttcttaagaatagtgttggtaaacatgaatacctt
ggtgaatataccggagagttgatctcccacagagaagcagataagcgtggaaagatatat
gaccgtgaaaattcgtcgtttcttttcaaccttaatgatcagtttgttcttgatgcctat
cggaagggtgataagttgaagtttgccaaccattctccagatccaaactgctatgcgaag
gttatcatggtagccggggatcacagggtaggtatatttgccaaagaacggataagtgca
ggagaggaactattctatgactatcgttatgaaccggatcgtgctcctgcttgggctcgg
aaacctgaatcgtctgtctcaaagaaggacgaatcacaaccgtccagtggccgcgccaaa
aaacttgcttaa

DBGET integrated database retrieval system