KEGG   Musa acuminata (wild Malaysian banana): 103973933Help
Entry
103973933         CDS       T03447                                 

Definition
(RefSeq) phosphopantothenate--cysteine ligase 2-like isoform X1
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00770  Pantothenate and CoA biosynthesis
mus01100  Metabolic pathways
Module
mus_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    103973933
Enzymes [BR:mus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     103973933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 103973933
NCBI-ProteinID: XP_009386880
LinkDB All DBs
Position
Unknown
AA seq 344 aa AA seqDB search
MIIFLIISSYSLRSFRLMDSKSGTETPQESGVESFFNSAPPLKDRDQISQKLEDFITKIS
ISSESGKPIRVVCVTSGGTTVPLEQRCVRYIDNFSSGNRGAASTEYFVKAGYAVIFVHRR
GSCQPYCRYLPQDSFLDFFDIAENSTIKVCEPHGTVVKGAIRDYRKAVEEGFLLKLPFTT
IFEYLQILQMVATSMRCLKSHGMFYLAAAVSDFYVPWENMAKHKIQSAEGPLDMRLNQVP
KMLLVLRKDWAPAAFCISFKLETDPDILLQKADMAMRKYGMHVVVANELATYKREVSVVT
SGEKTRVCSHGQDHDLEEELIDILVARHTEHIKKSSRIDVNEAL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatcattttcttgataatttcttcgtatagccttcgatcattcagactaatggattcg
aaaagtggaacggaaactcctcaggaatctggtgtggaatccttcttcaactcagctcca
cctctcaaagatcgtgatcaaatttctcagaagttagaagacttcatcactaagatttct
atatcatcagaaagtgggaaacctattagggttgtttgtgtgacttctgggggaacaact
gttcctttggagcagcgatgtgtccgttacattgataatttcagttcgggtaacagggga
gctgcatctacagagtactttgtgaaggctggatatgcagttatctttgtccatcgtcgg
ggaagctgccaaccatactgcagatatcttccacaggattcatttcttgatttttttgat
atagcagagaactcaactatcaaagtgtgtgagccacatggtacggtggtcaagggagca
attagggactatcgaaaggcagttgaagaaggcttcttgctgaaacttccattcaccaca
atttttgaatatcttcagattttacagatggtggctacatcaatgagatgtcttaagtca
catgggatgttctatcttgctgctgcagtatcggacttctatgttccttgggaaaacatg
gcaaaacataagatccaatctgcagaaggtcctctggatatgcgactcaaccaggtgcct
aaaatgcttttggtgctgcgaaaagactgggctcctgcagcattttgcatttcattcaag
ttggagacagatccagatattctgcttcagaaagctgacatggcaatgcggaagtatggc
atgcacgttgttgtagcaaatgaactggcgacttacaaaagggaagtctccgtcgttaca
agtggagaaaaaactagagtttgtagtcacggacaggatcatgacttggaggaggaactc
atcgatatcctcgtggcgaggcatactgagcacatcaagaagtcctctcgaatagatgta
aacgaagccctgtaa

DBGET integrated database retrieval system