KEGG   Musa acuminata (wild Malaysian banana): 103977465Help
Entry
103977465         CDS       T03447                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00010  Glycolysis / Gluconeogenesis
mus00053  Ascorbate and aldarate metabolism
mus00071  Fatty acid degradation
mus00280  Valine, leucine and isoleucine degradation
mus00310  Lysine degradation
mus00330  Arginine and proline metabolism
mus00340  Histidine metabolism
mus00380  Tryptophan metabolism
mus00410  beta-Alanine metabolism
mus00561  Glycerolipid metabolism
mus00620  Pyruvate metabolism
mus00903  Limonene and pinene degradation
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103977465
   00053 Ascorbate and aldarate metabolism
    103977465
   00620 Pyruvate metabolism
    103977465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103977465
   00561 Glycerolipid metabolism
    103977465
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103977465
   00310 Lysine degradation
    103977465
   00330 Arginine and proline metabolism
    103977465
   00340 Histidine metabolism
    103977465
   00380 Tryptophan metabolism
    103977465
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103977465
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103977465
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103977465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 103977465
NCBI-ProteinID: XP_009391256
LinkDB All DBs
Position
3
AA seq 541 aa AA seqDB search
MAARWIGSSLLSRSRSASSRALAYSLFRKGIDGSASGVFRRFSIAAAIEEPISPPVQVKY
SQLLINGKFVDSASGKTFPTLDPRSGEVIAQVAEGDAEDVNRAVTAARKAFDEGPWPRMT
AYERSRILNRFADLIEKHNDEIAALETWDNGKPFEQASQIEIPMLARLMRYYAGWADKIH
GLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMYAWKVGPALACGNTIVLKTAEQTPLS
ALYVSKLFLEAGLPEGVLNVISGFGPTAGAALASHMDVDKLAFTGSTSTGKIVLELAARS
NLKPVTLELGGKSPMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIE
KAKARAIKRVVGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYY
IQPTIFTDVQDGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTAN
TLMRALRVGSVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAW
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcggtggatcgggtcttctctcctctcgcgctctcgctccgcttcttctcgc
gctctcgcctactccctctttcggaaaggaatagatggttcggcgtctggggtctttcga
aggtttagcattgctgcggcgatcgaagaaccgatttcaccaccagtgcaagtaaagtac
tcgcagcttttaataaatgggaaatttgtggactcagcatcaggaaagactttcccaacc
ttggatcctaggtccggggaagtcattgctcaggttgctgaaggagatgcagaagatgtc
aaccgagccgtcaccgctgctcgcaaggcatttgatgaaggaccatggcctaggatgact
gcttatgaaagatcgcgcatacttaaccggtttgcagatctgatagagaaacacaatgat
gagattgctgcacttgagacttgggacaatgggaagccatttgaacaggcttctcaaatt
gaaattccaatgcttgcacgtctgatgagatactatgccggttgggcagataagatccat
gggcttgtcgtgccagctgatggcccgcaccatgttcaggtcttgcatgagccaattggt
gttgcaggccaaatcatcccctggaattttcctcttcttatgtatgcttggaaggtgggg
cctgcattagcatgtgggaacactatcgttctgaagactgcagaacaaactcctttatct
gccctatatgtgtcaaagctattccttgaggctggtcttcctgagggtgttctaaatgtg
atatccggatttgggcctactgctggtgcagctcttgctagtcacatggatgttgataag
cttgcttttaccggatctactagcaccggcaaaattgtactcgaactggccgcaagaagc
aatcttaagccagtgacactagaacttgggggaaaatctccaatgatagtaatggatgat
gctgatattgaccaggctgtagagcttgcgcattttgctttattctttaatcaggggcag
tgctgctgcgctgggtctcgtacatttgtacatgagcgtgtatatgatgagtttatagag
aaagcaaaagctcgtgcgataaaacgtgtcgttggtgaccccttcattaagggtgttgaa
caaggccctcagattgacgaggagcagttcagcaagatcttgcattacatcaaatctggg
gttgaagacggtgctacccttgtaacaggaggcactcgagcagggaccaaaggctactac
attcaacccaccatcttcactgatgtacaggatggtatgaagatagcacaagaagaaatc
tttgggccagttcagtcgatccttaagttcaaggatctcaatgaggtgatccaaagatca
aacaaaactcgctatggtctggctgctggtgtattcactaacaatctgcatactgcaaac
accttgatgcgtgccctaagggttggatcagtatggatcaactgcttcgatgtctttgat
gccgcaattccctttggtggctacaagatgagcgggcaaggcagggagaagggcatcgac
agcctcaagaactacttgcagatcaaggcagttgtcactcccttgaacaatcctgcatgg
ttgtaa

DBGET integrated database retrieval system