KEGG   Musa acuminata (wild Malaysian banana): 103978458Help
Entry
103978458         CDS       T03447                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00010  Glycolysis / Gluconeogenesis
mus00051  Fructose and mannose metabolism
mus00052  Galactose metabolism
mus00500  Starch and sucrose metabolism
mus00520  Amino sugar and nucleotide sugar metabolism
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
mus01200  Carbon metabolism
Module
mus_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mus_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103978458
   00051 Fructose and mannose metabolism
    103978458
   00052 Galactose metabolism
    103978458
   00500 Starch and sucrose metabolism
    103978458
   00520 Amino sugar and nucleotide sugar metabolism
    103978458
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103978458
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mus04131]
    103978458
Enzymes [BR:mus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103978458
Membrane trafficking [BR:mus04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103978458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 103978458
NCBI-ProteinID: XP_009392524
UniProt: M0SF48
LinkDB All DBs
Position
3
AA seq 500 aa AA seqDB search
MGKAAVTTAVVCAAAACAVAALVVRYRMRSSGRWARVAALLKELEERCATPVGKLRQVAD
AMAVEMHAGLASEGGSKLKMLISYVNNLPTGEETGLFYALDLGGTNFRVLRVQLGGKERH
VLKQEFEEVSIPPLLMVGGSDELFDFIASALAKFVASEGEDFHLPVGRQREIGFTFSFPV
RQTSIASGTLIKWTKGFNIDETVGEDVVAELTRAIERQGLDMRVSALINDTVGTLAGGRY
HDNDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTDYDQ
ALDNESLNPSEQIFEKLISGMYLGEILRRVLLRLAKEASLFGDSVPPKLEIPFMLRTPVM
SAMHHDTSPDLKVVGAKLKDLLGIPNTSLKARKVVVQICDIVARRGARLAAAGVAGILKK
VGRDTAVKGGESVPRTVVAMDGGLYEHYTIFRECLQATFEEMLGAEAAASVVIKLANDGS
GIGAALLAASHSQYRELEQS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggcggcggtgacgacggcggtggtgtgcgccgcggcggcatgcgcggtggcg
gcgctggtcgtgcggtaccggatgcggagctccggtaggtgggcgcgggtcgccgccctg
ctgaaggagcttgaggagcggtgcgccacgcccgttgggaagctgcgacaggtggcggac
gcgatggcggtggagatgcacgccgggctcgcctccgagggcgggagcaagctaaagatg
ctaatcagctacgtcaacaacctcccgaccggggaggagacagggttgttttatgcttta
gaccttggcggaaccaacttccgcgtcctacgtgtgcaactggggggtaaggagaggcat
gtactaaagcaagaatttgaggaggtctccattccaccgcttctaatggttggaggctca
gatgaactttttgatttcattgcttcagctttagcaaagtttgttgcttctgaaggtgaa
gattttcaccttcctgttggtaggcagagggaaattggatttaccttttcttttcctgtg
agacaaacctctatagcatcaggcaccttaattaaatggacgaaaggtttcaatattgat
gagacggttggggaagatgtggtggctgaattgactagggccatagaaagacaaggtctt
gatatgcgagtatcagctttgattaatgataccgttggaacattagctggggggagatat
catgataatgatgtagttgctgccgtgatattgggcaccggcacaaatgcagcctatgta
gagcgtgcccacgcaatacctaagtggcacggtctcttgccaaaatcaggagagatggtt
atcaacatggagtggggaaactttaggtcatcccatcttcctttaacagactatgatcaa
gcattagataatgagagtttgaaccctagtgaacagatttttgaaaagttgatctctgga
atgtacctgggagaaattttacgacgagtccttttgcggctggctaaggaagcttccctt
ttcggagacagtgttcctccaaaacttgaaattccgttcatgctacggactccagtcatg
tcagccatgcatcacgacacatcacctgatcttaaagttgttggtgccaaactgaaggac
ctcttggggatccccaacacctctctcaaagcaagaaaagtggtggtccagatctgcgac
atcgtcgccaggcgtggcgctcgcttggccgccgctggtgtagccggcatcctgaagaag
gtcgggcgagacacggcggtgaagggcggagagagcgtgccaaggacggtcgtcgccatg
gatggtggactctacgagcattacaccatattccgcgagtgcttgcaggccaccttcgag
gagatgctcggagccgaggccgcagcttctgtcgtcatcaagctagcaaatgacggatcg
ggcatcggcgccgccctcctcgcagcttctcactctcagtatcgagaactcgaacagtcc
tga

DBGET integrated database retrieval system