KEGG   Musa acuminata (wild Malaysian banana): 103979077Help
Entry
103979077         CDS       T03447                                 

Definition
(RefSeq) calcium-dependent protein kinase 26
Organism
mus  Musa acuminata (wild Malaysian banana)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like YrbL-PhoP_reg APH Kdo CUB_2 Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 103979077
NCBI-ProteinID: XP_009393380
LinkDB All DBs
Position
1
AA seq 515 aa AA seqDB search
MAVAKGNSRDPPYNCYKVPGLSNPILETPHISYLEDRYVLLEELGWGQFGVIRACSDMLT
GESVACKSIAKDRLVTPEDIRSIKLEIEVMARLSGHPNVVDLKAVYEDNDYVHLVMELCA
GGELFHRLEKHGCFSEHEAAVLFRHLMEVVMYCHDKGVVHRDLKPENILLATKSLSSPIK
LADFGLATYIKPGQSLSGTVGSPFYIAPEVLSGGYNEAADVWSSGVILYILLSGMPPFWG
KTKSRIFESVRSAELRFPSDPWQSISDSAKDLIGGMLCRDPTQRLTAKQVLDHSWITEHT
QQPEVSCGQCHEVSFTPGDLGNSSFSTPLVSASRDVSFSTSSLIPCQRVEDHSLPAFTCR
SSCSSFIVDVPFSSTISFSFQNGCESDGMRFCSQMPVVPSFAFFMPEQQKPFSFTSEELK
IKASQTDSSLRKLSVLPYSAACSSRDLRELDHKGLEARRGLGTNSRAIGIHSRRNHTIGL
GERDQLDLVVSESVIRWASCTHLSSAPSLRSSLVC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgccaagggcaacagcagagatccaccttacaactgctacaaggtccctggc
ctcagtaatcccatcctagaaaccccccatatatcataccttgaggaccgatatgtttta
ctggaagaattgggttggggacaattcggagttatcagggcttgctctgacatgcttacc
ggagagtcggtcgcctgcaagtctattgccaaggatcgtcttgtcacacctgaggatatc
cggagcatcaagcttgagattgaggtcatggcacggctctcaggccaccccaacgttgtc
gacctcaaggctgtatatgaggataatgactatgtgcatcttgtgatggagctctgtgct
ggtggcgagctttttcaccggcttgagaaacatggttgcttctctgaacatgaggctgct
gttctcttccggcatctcatggaagtcgtgatgtactgccatgacaaaggtgtggttcac
agggacctgaagccggagaacattttgctggctacaaagtctttatcttcaccaatcaaa
ctggcagactttggactagctacttatatcaagccagggcagagcttgtctgggactgtt
ggaagtccattttacattgcaccagaggtattgtctgggggatacaatgaagcagcagat
gtatggagttctggagtgattctttacattcttcttagtggaatgccacccttttggggg
aagaccaaatcaaggatatttgaatcagttaggtctgcagagctacgatttccatctgat
ccatggcaaagcatatctgactctgcaaaggacttaattggaggaatgttatgtagagat
cctactcagagactcacagctaaacaggttttagatcattcctggataacagaacacaca
cagcaaccagaagtctcatgcgggcaatgccatgaagtcagttttacaccgggagacctg
ggaaactcttcattctctacccctcttgtgtctgcaagccgtgatgtcagcttcagtact
agttccctcattccctgccagagagttgaagaccattctttgcctgcattcacatgcaga
tcatcatgctcctcatttattgttgatgttccattctcttctactatcagcttctctttc
cagaatggctgtgaatcggatggcatgagattctgctcacaaatgccggtggtgccaagt
tttgctttcttcatgcctgagcaacaaaaaccattcagttttacgagtgaagaattaaag
atcaaggcatctcagactgactcaagcttgaggaagctctctgtgttaccctactcggct
gcatgctctagtcgagacttaagagaattggatcataaagggcttgaagctagaagagga
ctcggaactaattccagagccattggcatccacagcagaaggaaccacaccatcgggctt
ggtgagcgtgaccagcttgatcttgtggtttcggagtcggtcatacgttgggcatcatgc
acgcacctctcaagtgcaccgtcccttaggtcctcccttgtatgttga

DBGET integrated database retrieval system