KEGG   Musa acuminata (wild Malaysian banana): 103980906Help
Entry
103980906         CDS       T03447                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00620  Pyruvate metabolism
mus00710  Carbon fixation in photosynthetic organisms
mus01100  Metabolic pathways
mus01200  Carbon metabolism
Module
mus_M00168  CAM (Crassulacean acid metabolism), dark
mus_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
mus_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
mus_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103980906
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103980906
Enzymes [BR:mus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103980906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 103980906
NCBI-ProteinID: XP_009395707
LinkDB All DBs
Position
4
AA seq 963 aa AA seqDB search
MTRLEKTASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLREMVQECYE
HSAEYERKHDPRKLEELGNELTSLDPGDLIVVTKSFSHMLNLANLAEEVQIAYRRRIKLK
KGDFADENSATTESDIEETLKRLVAQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRSLL
QKHARIRNCLTQLTAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSY
FHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV
CLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRADQLHRSSKKDAKHYIEFWKKVPPS
EPYRVVLSDVRDKLYNTRERSRHLLSNGYSDIPEEATFTNVDQFLEPLELCYRSLCDCGD
RPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLGIGSYREWSEEQRQE
WLLSELNGKRPLFGPDLPKTDEIADVLDTFHVIAELPPDNFGAYIISMATTPSDVLAVEL
LQRECHVKKSLRVVPLFEKLADLDAAPAAVARLFSIEWYRNRIDGKQEVMIGYSDSGKDA
GRLSAAWQLYKAQEELVKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSL
RVTVQGEVIEQCFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALMDEMAIVATEEY
RSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHL
PVWLGFGAAFKHVLQKDIRNVHILQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDKLL
VSEDLWGFGGRLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLLLRDAYITTLNVCQAYT
LKRIRDPSYHVNVRPHLSREISESTKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGMQ
NTG
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgactcggttggagaagacggcgtcgatcgatgcccagttgaggcttctggcgccgggg
aaggtgtccgaggatgataagttggtcgagtacgacgcccttcttttagatcggttcctc
gacatcctccaggatttgcacggtgaagatctcagagaaatggttcaagaatgctatgaa
cattctgctgagtatgaacggaagcatgacccgaggaaacttgaggagctgggtaatgaa
ctgacaagtctggatcctggcgatttaatcgttgttaccaaatcattctcgcacatgctt
aacttagccaacttggctgaggaggtgcagattgcctatcgcagaagaatcaaactaaag
aagggtgattttgctgatgagaactctgcaactactgaatcagacattgaagagacccta
aagcgtctagtagcgcagttaaagaagtccccagaagaggtctttgatgctctcaagaac
cagacggttgatcttgttttgactgcacatccaactcagtcagtcagaaggtccctgctt
cagaagcatgcaaggataagaaactgtctgacgcagttgactgccaaggatatcactcct
gatgacaagcaggagcttgatgaggctcttcagagagagattcaagccgcctttaggact
gatgagatccgaagaactcctcccactcctcaagatgaaatgagggctggaatgagctat
tttcatgaaacaatatggaagggtgttcctaagttcttaaggcgagtggatacagcactt
aaaaacataggaatagatgagcgtgtaccctataatgctcctttgattcagttttcttca
tggatgggtggggatcgtgatggaaatcccagagttacaccggaggttacaagggatgtg
tgcttgttggctagaatgatggctgcaaacttgtactattcccagatagaggatctcatg
tttgagttgtctatgtggcgctgcaacgatgaactccgagtacgtgcagatcaactacat
cgctcctcgaagaaagatgcaaaacactacatagaattttggaaaaaagtccctccaagt
gaaccttatcgtgttgtgctaagtgatgtcagggacaagctatacaacacacgggagcgt
tctcgccatttactgtctaatggatattctgacattcctgaagaagcaactttcaccaat
gttgaccagtttctggagcctcttgagctctgttacagatcgctctgtgattgtggtgat
aggcccattgctgatggaagcctccttgatttcttgcgccaagtgtcaacctttggcctg
tctcttgtgaggcttgatatcaggcaagagtctgacaggcacactgatgttattgatgca
atcaccaagcacctgggaattgggtcgtatcgtgaatggtctgaggaacaacgtcaggaa
tggctgttgtctgaacttaatggaaaacgtcctttatttggtcctgacctacccaagacc
gatgaaattgctgatgttttagacacattccatgttatagccgaacttcctccggacaat
tttggggcttatatcatttcaatggcaacaacaccatcagatgttcttgccgttgagctg
ttgcagcgtgaatgccatgtgaagaagtcattgagagtagtgccactgtttgagaaactt
gcagatcttgatgcagctcctgcagctgtagcccgacttttttcaattgaatggtacagg
aataggattgatggtaaacaggaagttatgattgggtattcagattctggaaaggatgcc
gggcgtctttctgcagcgtggcagttatataaagctcaagaggaacttgtaaaggtagct
aagcaatatggagtgaaattaacaatgtttcatgggcgagggggaactgttggaagagga
ggcggtcctactcatcttgctatattgtctcagccaccagacacgatacatggatccctc
cgagttacagttcaaggtgaagtaatagagcagtgttttggggaggaacatttatgcttc
agaactcttcaacgtttcacagctgctacacttgagcatggaatgcgtccccccatttct
ccaaaaccagaatggcgtgctttgatggatgagatggctattgtggctacagaggagtat
cgatcaattgtcttccaagaaccacgttttgtcgagtatttccgactggcgacacctgag
ctggagtatggtagaatgaacattggcagcagaccttcaaaaagaaagcccagcggaggc
attgaatcactacgtgcaatcccatggatttttgcatggacgcagacacggtttcacctt
cctgtgtggcttggatttggtgcggcattcaagcatgtgttgcagaaggatatcaggaat
gttcacattttacaggagatgtacaatgaatggccatttttcagggtcacaatcgatttg
gtggagatggtctttgctaaaggagatcctggaatagctgcattgtatgataaacttcta
gtgtccgaggatttgtggggctttggggggcgactcagagccaactatgaagaaacaaag
cgtcttcttcttcaggtcgctggtcacaaagatcttcttgaaggggatccatacttgaag
cagcggctgctgctgcgtgatgcttacattacaacccttaatgtttgccaagcctacaca
ctgaagcgtattagagacccgagctaccatgtcaatgtgagaccccatctgtcgagggag
atatcagagtccaccaaaccagcagcagaattggtgaagctgaacccaacaagcgagtat
gcccctgggctggaggacaccctcatcttgacgatgaagggtatcgctgccggcatgcag
aacactggctga

DBGET integrated database retrieval system