KEGG   Musa acuminata (wild Malaysian banana): 103982275Help
Entry
103982275         CDS       T03447                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00250  Alanine, aspartate and glutamate metabolism
mus00410  beta-Alanine metabolism
mus00430  Taurine and hypotaurine metabolism
mus00650  Butanoate metabolism
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103982275
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103982275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103982275
   00430 Taurine and hypotaurine metabolism
    103982275
Enzymes [BR:mus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103982275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103982275
NCBI-ProteinID: XP_009397439
UniProt: M0STN9
LinkDB All DBs
Position
4
AA seq 489 aa AA seqDB search
MALSRIASETDVSIQHTFASRYVRDSLPRFRMPANSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGESEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDDYFVMDPHKAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLTQKNKETGWDTP
IHVDAASGGFIAPFLYPDLTWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNIIENCQENALVLKNGLEK
TGRFNIVSKDNGVPLVAFSLKDRSRHDEFEVSDFLRRYGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVHDIERVLHELDALPPKNNGEEAKHAREMKIQRSVTEALKKMVLASK
AKGKTTGVC
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcgctctcgaggatcgcatcggagacggacgtgtcgatccagcacaccttcgcctcc
cgctacgtccgcgattccctccccaggttccggatgccggcgaactcgatccccaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacgggaacccgcggctgaacctg
gcgtcgttcgtcaccacctggatggagccggagtgcgacaagctcatcatggccgccgtc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgagctccagaatcgatgt
gtgaacatgattgcccatctcttcaatgctcctatcggtgagtcagaggctgcggtggga
gttggaactgtgggctcttcagaagccataatgcttgctgggctagccttcaagaggaaa
tggcagaacaagaggaaagcagaaggcaagccttgtgacaaaccgaacattgtcaccggt
gccaacgtacaagtctgctgggagaagttcgcgaggtactttgaggtggaacttaaggaa
gtgaagctgagggatgattactttgtcatggaccctcacaaagcagttgacatggttgat
gagaacaccatttgtgttgccgcaatcctaggttcaacccttaatggagaattcgaggat
gtgaagcttctcaatgacctcttaactcagaagaacaaggaaactggttgggacacacca
atccatgttgatgctgcgagcggtgggttcattgcaccattcttgtacccagacctgaca
tgggacttcagactaccgctagtgaagagcattaatgtcagtggccacaaatatggtctt
gtgtatgctggcatcggatgggtcatctggcggagcaaggaggacttacctgaagaactc
atcttccacatcaactaccttggcaccgatcaacctacattcactctcaacttctccaaa
ggctctagccaagtcattgctcagtactaccaactaattcgcttgggttatgaggggtac
aagaacataattgagaactgtcaggagaatgctttggtgctgaagaatggccttgagaag
actgggcggttcaacatagtctccaaggacaatggtgtaccccttgtggcgttctcgctc
aaggaccgaagtcgacatgatgagtttgaggtgtcagatttcttacgcaggtatgggtgg
attgtgccggcatacaccatgccgcctgatgcacagcacgtgaccgttctccgtgtcgtc
atccgggaggacttcagccggacattggcagagcgtctcgttcacgacattgagagggtg
ttgcatgagcttgatgcactcccaccaaagaacaatggcgaggaggccaagcatgccaga
gagatgaagatacaacgctctgtgactgaagctttgaagaagatggtcttggccagcaag
gccaaaggcaagaccactggagtttgttaa

DBGET integrated database retrieval system