KEGG   Musa acuminata (wild Malaysian banana): 103986206Help
Entry
103986206         CDS       T03447                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
KEGG Orthology (KO) [BR:mus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mus01001]
    103986206
Enzymes [BR:mus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103986206
Protein kinases [BR:mus01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   103986206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo FTA2 Pkinase_C APH RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 103986206
NCBI-ProteinID: XP_009402414
LinkDB All DBs
Position
5
AA seq 480 aa AA seqDB search
MVSSEMNSVTKITGRKNLNMEILLPTGPPDVAVSENVEFDFSDVFGPGPVQTSVNVNVMN
PDNQAPESVPNETVYDDPVVIYKRSHSLVGPSTPVSQSLQLSKLTIHETDNSLELLECAS
EVTGDLESSTSFTETHDSISEKCEVIGLSDFEVLKLVGKGAFGKVFQVKKRGTSEIYAMK
VMRKDKIMEKNHAEYMKAERDILTKVDHPFIVQLRYSFQTKYRLYLVLDFINGGHLFFQL
YNHGLFREDLARTYAAEIVSAVSHLHANGIMHRDLKPENILLDADGHAMLTDFGLAKEFD
ENTRSNSLCGTLEYMAPEIVLGKGHDKAADWWSVGILLFEMLTGKPPFFSSNREKMQQKI
MREKIKLPAYLSSEAHSLLKGLLQKEASKRLGSGPGGSNEIKNHKWFKSIYWRKLEAREI
LPSFRPNVAGKTCIANFDERWTSMSVLDSPVASPVAGENDFAGFTYVRPAPFLQKPSPLS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctgagatgaatagtgtgaccaaaatcaccggtcgcaagaacttaaacatg
gagatacttcttccaacaggcccccctgatgttgcggtatctgagaacgtggagtttgat
ttctctgatgtgtttggtcctggccctgttcagacctcagttaacgtgaatgttatgaat
cctgataatcaggcacctgaatcggttccaaatgagacagtttatgatgatccagtggtc
atttacaagcgatcacattctttggtggggccttcaactccagttagtcagtccttgcag
ctcagtaaactcacaatacatgagactgacaattcattggaacttttggagtgtgcgtct
gaagtgactggtgatctggagtcatccacctcttttacggagacgcatgattcaatatct
gaaaaatgtgaggtcatagggctttcagactttgaggttttgaagctagttgggaaaggt
gcatttggaaaagtctttcaggtgaaaaagagaggcacttctgaaatctatgcgatgaag
gttatgcggaaggataagattatggaaaagaaccatgctgaatacatgaaagctgagcga
gatattttgacaaaagttgatcaccctttcatcgtccaactaagatactcattccagaca
aagtaccgcctatatcttgtgctcgattttataaatggaggacatctattttttcagctc
tataaccatggcttgttcagagaggatcttgctcgcacgtatgcagctgaaatagtatct
gctgtttcccaccttcatgcgaatggtataatgcacagggacctcaagcctgagaacatt
ctcctcgatgcagacggtcatgccatgttaactgactttggtctggcaaaagagtttgat
gaaaatactagatcaaactccctctgtgggacgctcgagtacatggctcctgaaatcgtt
ctcggaaaaggccatgacaaagctgctgattggtggagtgttggaatcctgttgttcgag
atgctcactgggaagccaccttttttcagtagtaacagagagaaaatgcaacagaagata
atgagggagaagataaagctgcctgcttacttgtccagcgaagcccattccttactgaaa
ggcttgttgcagaaagaagcaagcaagcggctcgggagtggccctggtgggagcaacgag
ataaagaaccataagtggttcaaatcgatctactggcgaaaactggaggcccgtgaaatc
ctgcctagcttccggcctaatgttgccggaaagacctgcatcgccaacttcgacgagcga
tggacgagcatgtcggtgttggattcgccggtcgcaagcccggtcgccggagagaacgac
tttgcagggttcacgtacgtgaggcctgctcctttccttcagaagcccagccctctaagc
tga

DBGET integrated database retrieval system