KEGG   Musa acuminata (wild Malaysian banana): 103987359Help
Entry
103987359         CDS       T03447                                 

Definition
(RefSeq) serine/threonine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mus00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    103987359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mus01001]
    103987359
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mus03032]
    103987359
   03400 DNA repair and recombination proteins [BR:mus03400]
    103987359
Enzymes [BR:mus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103987359
Protein kinases [BR:mus01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   103987359
DNA replication proteins [BR:mus03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     103987359
DNA repair and recombination proteins [BR:mus03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    103987359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC TAN SOAR
Motif
Other DBs
NCBI-GeneID: 103987359
NCBI-ProteinID: XP_009403918
LinkDB All DBs
Position
6
AA seq 3016 aa AA seqDB search
MATSRDVQEIVSKLSSDKAKAREEGVKLLSSWLEGERAAGFCKLLGHNTAKIKADSIPHA
ETWPFLITLIMKCISLEVSASKKRLPRLIFVKTLRSSIQCAEDIKLSGRNFLLLSVVKVL
FSHIWDVIKDIPSFQSEYSSILRHLLTVREYRYQMRKRVYSGLVVLYINKLGTVIDMNTS
HTSSKEDVFRSIVILHVLLENPPGDYPDNIREDVVKGFIMIFSKIRNEGKILRKLVECLN
TYLLRDGPNLGNQAMEIHFAVQDIMFRCWFTSHDQGLKSSLINFARIQLKLIRYLAEGTQ
IIEQLLDVIVKELDQGINVGSEVLWNDISREDKLGTLGSIQQCLMELAATVFYQACKINS
KSTCDVKRLKMEHAAVRLKDGLIKGSWIWNGAFAFFIHNYGLRLDKALLIYWFEGAGESL
RRILSGSGTLHSHDALLWLLRALQEFSAVFPFFLHEEPSNSTSFTSNEVLLVKNGWQDIW
SCLMRGIPSFSSFSSIIDAALTLLGNMIKRDQASVAVMPLDVWNLRIFKRMPSESTLYFI
ACYFSRAGANGDLRDILYLRKDLLRATMELFDFKQASFWNEQMVSLIPEAIFALCAGCAT
LAPLSGGLSMFTRPNKDCNKLFLVKDELEHPEEVLECSVESLAEIESESSTEEKTNWCSC
VRLPKQIRRPLIHEFEEHISDFLTSKGEFGETVLSFFFSLCSLLCNSIYCSLLARLSEDK
FLILLKVIDFLTEILDHIVSVIDDKCNEMSCDGSVNLSFILDSAGTNASSLRSLLSSPLF
KLKDGDDCTDCVPLGRITQAIEKLLVAFAKLFDVLSKFPTDPVSDAEIQQLPISSVDSLQ
DSMAEFNVRIVDMELDADESFEDMDSVAMSGGRKLITSPLFWKLHLVSMISSFSSVLPFR
TWEVLFDLMGRENDSKVCESILFNLCKYFPGPAGRSSALVSMIGKLTENDGNLKFFYVNI
LTCIRVLLGSLKSISSTGNNTKAIQCMDERMTDENLSTLCNTLNRVAEFGLPDWYARIEL
INCICCSVLLEPQSAQVMVGRLLVMLQDPDYRVRLFLARKIGLLFHTWDGHNELFHDICL
NFGFKMVRGSKDSRIKAEDIIAAGPQPALAVETALITLAHLAFASEEIEIEAVFMICVIA
AMDPSHRELVYALFDNLSRRLQYASRCEYLEQLMGSILASWVACEVSLVALVEVQDLFIG
KSDIKCFMQYCCPWLLPPLILNGDNAGLDWVSKVSLQPLSVLVREYFVPICALCIAVHCS
MRPNKEIGGMALNNLILQFANISELERDELIKKHMVSIVSFLLSLSSCSVDPELPFFTKD
TVVLAVQTVVDGFLEMDDHPITVGIIDKINIFRADRIFMFLLEMHYKISAAVHSRHICHR
LTAVEVLTHIIGPRVTNPSSSYYIINIVGQLIGSQPLQEQCCVILSTLLKAFKAKPTKDV
YNVLGEELQFLVSKLVACCIPSESQNVKAVPPPPAVISLLHELTVDADPLLLGYIRELEP
FPEVDCLKKIRLFHNDLCKTYSARDHFLKFAKRAYYLPKGLLLWSLRNLHKRLLAGEIIE
KRPNDMEKLCERTCWNDNPDVVSAVWVLVDLCSSNEASTMSGLLADFISRAGIGDPCRVV
FHLPNGSSQNHTFLSSNLVCLKANRSYSNMEDSDEFLVYLLRLLKKFLADDSVETVDITS
RTLRGILSTEKGYTALLSLDPYEKSLIAVHSKGVNLELVERVLLDLGKNCHEMVSLEDSS
LWRTDNKTYKMWVCSLVHSFIHHCDDVILRLCQNLVLLKDEIAELLFPNVLVNLVRSVHS
DLLLCDIISAKVEENIFCESNGLVKSIQIMLDALNKLRSVYVSEIAGSLSTPVKHGRPSS
GGKTRGTSEISKYRSPNVSLSMSSWKKVYWLSIDYLMVAKAAIRCGSYFTAVMYVEHWCE
EHFNGLQLGCPDFSQLELLPSHIDLLMAAYTQINEPDSIYGIIQSNQLTSQIITFEHEGN
WSKALEYYDLLVRSASIGPGKHSVDDTLSSSHATEGRSCWKSYKGLMRSLQKTGCTHVLD
VYCQGLTISNGCLQHDTEFADMQYEAAWRSGNWDFSFVSGDASPPYSTQFASSGQFNENL
HSCLRALYEGNASEFHGKLIDSKKELVLSIASASRESTEYIHSTIVKLQILDHLGVAWDI
RWMSSHQVSTFYPKITDIACAPITPEKDQLGWLNAEWSVILRHTQLHLNLFEPFISFRRV
LLHILDCTECAIEHLLESASTFRKGSRFSLAAASLHELKQLCCQMKQKPISQIYFHGRLE
EAKLLKAQGRHDMAINLARYILQNHSMGEEMSNVYRLVGKWLAETRSSNSRIILEQYLKH
SVELTELSKDTDEKYISKQCQTYYHLAHYTDSLFQSYEERLASSEWQAALRLREHKTREL
DALIKRLKRSSKGEKTDYSAKIQELQKQLTMDREEAEKLHDDRDNFLGLALKGYQRCLLI
GGKYDLKVVFRLVSLWFNFYSRQNVVEEMISTVKEVQSYKFIPLVYQIASRLGSSKDGQG
STNFQIALVSLIRKMAIDHPYHTIFQLLALANGDRVKDKQRSRNSFIVDMDKKLAAENLL
SELSTYHGALIGQMKQLVEIYIKLAELETRKEETNKRVPLPREIRSLQQLELVPVVTATV
PVDPSCQYREGSFPHFRSLADSIMVMNGINAPKVVECLGSDGQIYRQLAKSGNDDLRQDA
VMEQFFGLVNNFLQNHRDTWKRRLRIRTYKVVPFTPSAGVLEWVDRTIPLGEYLLGSARN
GGAHGRYGVGDWSFLRCRECMTNEKDKRKAFLKICDNFRPVMHYFFLEKFLQPADWFQSR
LSYTRSVAASSMVGYIVGLGDRHSMNILIDQETAEVVHIDLGVAFEQGLMLKTPERVPFR
LTRDIIDGMGVTGVEGVFRRCCEETLSVMRTNKEALLTIIEVFIHDPLYKWALSPLKALQ
RQKETDDGIDACLESSQDACEGNKDAARATLRVKEKLDGYEAGEIRSVQGQVQQLIQDAI
DMDRLCHMFPGWAAWL
NT seq 9051 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctcgagggacgtccaagaaatcgtctccaagctctcgtctgataaagcgaaa
gcccgagaggaaggggtgaaactgttgagtagctggttggaaggcgagagggcggctggt
ttctgcaagctcctcggccataacaccgccaagattaaggcggattcaatccctcacgct
gaaacatggccttttctcatcacactgatcatgaaatgcatctcgttggaggtctctgca
agcaagaaacgccttcccaggttaatctttgtgaagactctgcgaagtagcatccaatgt
gcagaagatataaagctttcaggaagaaattttcttttgctttctgtcgttaaagtgcta
ttcagtcatatatgggatgttataaaggatattcctagcttccagtcggagtacagcagc
attcttcgacatcttctaactgttagagagtatcgctatcaaatgaggaagcgggtttat
tctggtctagtagtactatacatcaacaagttaggtactgtaatagatatgaatactagt
cataccagttccaaggaggatgttttccgcagtatagtgattcttcatgtccttttggaa
aacccacctggtgattatccagataatattcgagaggatgttgtgaagggattcattatg
atcttctcaaaaattcggaatgaggggaagattttacggaaactcgtggaatgcctgaat
acgtacttgttaagagatggcccaaatcttggcaatcaggccatggagattcattttgct
gtacaggatatcatgttcagatgttggtttacttctcatgatcaaggactaaagagttcc
ttgattaattttgcaagaattcagctaaagctaatacggtatctggctgaaggaactcag
ataatagagcaattacttgatgttattgtcaaggaacttgaccaaggcattaatgttggt
tcggaagttctttggaacgatatatctagagaggataagcttggaactctaggaagcatc
cagcaatgcctaatggagcttgcagccactgttttctatcaggcttgcaaaattaatagt
aaatcaacatgtgatgtaaaacggttgaaaatggagcatgctgcagtacgtttaaaagat
ggcctcatcaaaggttcctggatctggaatggggccttcgccttctttattcataattat
ggacttcgactagataaggctctgttaatctattggtttgaaggtgctggtgaaagttta
agaaggatattgagtggttcaggtactcttcattcacatgatgcacttctttggctttta
cgggcattgcaggaattttcagctgttttcccattcttccttcatgaagagccttccaac
agcacatcgttcacttcaaatgaggttttgttagttaaaaatggttggcaagatatatgg
agctgtttgatgcgtggaataccttcttttagtagtttctcctcaattattgacgctgct
ttgacactacttggcaatatgattaagagagaccaagctagtgtagctgtcatgcctcta
gatgtatggaaccttaggatatttaagcgcatgccttcagagtctactttgtacttcatc
gcttgctatttctctcgagcaggtgctaatggtgatcttagagacattctgtatcttaga
aaagatttactcagagcaactatggaattatttgacttcaagcaagctagtttttggaac
gagcaaatggtttctcttattcctgaagccatatttgctctttgtgctggttgtgcaact
ttagcacctctttctggaggcttatccatgtttacaaggcccaacaaagattgtaataag
ctgtttctggtgaaggatgagctggaacacccagaggaagttttagaatgttctgtggaa
tctttagcagaaatagaatcagaatcttctactgaggagaaaaccaattggtgtagttgt
gtacgtcttcccaagcagattagacggccattgatacatgaatttgaggaacatatatct
gattttctgacttcgaagggggagtttggggaaacggttctttcattttttttttctctg
tgttcccttttgtgcaatagcatctactgctcattactagcaaggctcagtgaagataag
ttcttaatcctccttaaggtgattgattttctgacagagattttggaccatattgtttca
gtgatcgacgataagtgcaatgaaatgagttgtgatggttctgttaatttaagtttcatt
cttgactctgctggcaccaatgcttcctctcttcgtagcttattatcctcaccactgttt
aagcttaaggatggcgatgattgcactgattgtgtcccacttggtaggatcacacaagct
attgagaaactattggtggcttttgctaagctatttgatgtgttgtcaaagtttccaact
gatccggtttctgatgctgagattcaacagctacctatatcttctgtggattctctgcag
gattctatggctgaatttaatgtcagaattgttgacatggagcttgatgctgatgaaagt
ttcgaagatatggattctgtggccatgagtggggggagaaagttgatcacttcacctttg
ttttggaagctacacttggtttctatgatttcaagtttttcttcagtattaccgttccgt
acatgggaagtcttgtttgatttaatggggagagaaaatgattctaaggtttgtgaaagt
attctgtttaatctttgcaagtattttcctggtcctgctggaagatcatctgccttggtt
agtatgattggtaaattgacagaaaatgatggaaatctaaagttcttttatgtaaatatt
ttgacttgcatccgtgttctgttgggttctttaaagtcaatctcttcaactggaaataat
accaaagctatacaatgcatggatgaaaggatgaccgatgagaacttaagtactctctgt
aacacactaaatagagttgctgagtttggacttcctgattggtatgctcgtattgagctg
attaattgcatttgttgttctgttttgctggagcctcaatctgcccaggttatggttgga
cgacttctagtgatgcttcaagatcccgattatcgggttagactctttttagcaagaaaa
attggtctcctttttcatacatgggatggtcataacgagttgttccatgatatttgtttg
aattttggtttcaagatggtgaggggttcaaaagactcgaggataaaagctgaagatatc
attgctgctggtcctcagcctgctcttgctgtagaaactgctcttattaccttagcacat
cttgcctttgctagtgaggaaatagaaatcgaggctgtcttcatgatatgtgtgatagct
gctatggatccgtctcatagggaactggtatatgctctttttgataatttatcaagacga
ctccagtatgcttctagatgtgagtacctggagcaactaatgggatcaattcttgcttct
tgggtagcttgtgaagtaagcttagtggctctagttgaggtgcaagatctttttattggt
aaatcagatataaaatgcttcatgcaatactgctgtccatggttgcttcctccattgata
ttaaatggagataatgctggtcttgactgggtatcgaaggtttctcttcagccattgtct
gttcttgtgcgggaatactttgtgcctatttgtgcattgtgcattgctgttcattgtagt
atgagaccaaacaaggaaattggtggcatggcccttaacaatttaatcttgcaatttgcc
aatatttctgagcttgagcgagatgaacttataaagaaacacatggtgtcaattgtcagc
ttccttttgtcactttcatcctgctcagttgatccagaattgccattctttacaaaggat
actgtggttcttgcagtgcaaacagttgttgatggttttctggagatggatgatcatccc
attactgttggtattattgacaaaattaacattttccgtgccgatagaattttcatgttt
ttattggagatgcattacaagataagtgctgctgttcattctcggcatatttgtcatcga
ttaactgcagttgaggtccttactcatatcatagggcctagggttactaatcctagcagt
tcctactatattatcaatattgttgggcagttaattggaagtcaacccctgcaagaacag
tgttgtgttatcctttccacgttactgaaggcatttaaagctaaaccaaccaaagatgtg
tacaatgtgcttggtgaagagcttcagtttttggtttcaaaattggtagcctgttgcatt
ccttctgaatctcagaatgtaaaagcagttcctcctccaccagctgtgatatctttactt
catgagctgactgttgatgctgacccattacttctaggctacatcagagagttggaacca
ttccctgaggttgattgcttgaagaaaatacggctgtttcataatgacctctgcaagaca
tattctgcaagggatcattttttgaagtttgcaaagagagcttattaccttccaaagggc
ctacttttatggagtctccgaaacctgcataaaaggttgctcgctggtgaaattattgag
aaaaggccaaatgatatggaaaaattatgtgagagaacctgctggaatgataatccagat
gttgtcagtgctgtttgggtgcttgttgacttgtgtagctcaaatgaggcaagcactatg
agtggactgcttgctgatttcatttctcgggctggaataggtgatccttgccgtgttgtt
ttccatttgccaaatggttcaagtcaaaatcatacttttctgtcatcaaaccttgtttgc
ctgaaggcaaataggtcatattccaatatggaggactcagatgagtttttggtttatctt
ttgagattgttgaagaaatttctagcagatgattctgtcgagactgtggacataacttca
cgaacattgaggggtattctttcaactgaaaagggctacactgcattgttatctcttgat
ccttatgagaagtctctaattgcggttcactctaagggtgttaatctcgaacttgtagaa
agggtactcttagatttgggaaaaaattgtcatgagatggtttcattggaagattcttct
ttgtggaggacggacaataaaacttacaaaatgtgggtctgctcactggtgcactcattc
attcatcattgtgatgatgtaattttaagattgtgccaaaatttagtgttactaaaagat
gagattgccgagcttttgtttccaaatgtcttggtgaacctagtgcgaagtgtccattca
gatcttctactttgtgatataatctcagcaaaggttgaggagaacatcttttgtgaatcc
aatggattggttaagtcaattcaaattatgctagatgcattaaataaacttcgatctgtt
tatgttagtgaaatagctggttctctgtcaactccagtgaagcatggcagaccctcaagt
ggtggaaaaacccgtggcacatcagaaatatcaaaatatcgttctccaaatgtttctttg
tcaatgtcttcatggaaaaaggtgtactggctttcaatcgactatcttatggttgctaaa
gcagcaattcgttgtggatcatacttcacggcagttatgtatgtcgagcattggtgtgaa
gaacactttaatggtcttcaattaggatgtcctgatttctcacaactagaattgttgcct
tcacatatcgacctacttatggctgcatacacacagattaatgagcctgatagtatatat
ggaatcatccaatcaaatcagctgacatcacagataattacattcgagcatgagggaaac
tggagtaaagctctggagtattatgacttgcttgtaagatcagcttcaattggcccagga
aagcattctgtagatgacacactcagttcttctcatgccactgaaggaaggagttgttgg
aaatcatacaaaggtttgatgagatcattgcagaaaactggttgcactcatgtattggac
gtatattgccaaggattgactatttccaatggctgcttgcaacatgatactgaatttgct
gatatgcagtatgaagctgcttggaggtctggaaattgggacttctcatttgtcagcgga
gatgcaagtcctccatattctacacaatttgcaagtagtggtcaattcaatgagaacttg
catagttgcttaagagccttgtacgagggcaatgccagcgagttccatggaaaacttata
gattcaaagaaggagcttgtgctgtctatcgcaagtgcaagcagggaaagtactgaatat
atccattcaacaatagtgaaacttcagatattggaccatcttggtgtggcctgggatatt
cgttggatgtcatcccatcaagtatcaacattttacccaaagatcactgatatagcatgt
gcacctattactcctgaaaaagaccagctgggctggcttaatgctgaatggagtgttatc
ctcagacatacacagctacatctaaatttgttcgaacctttcatttcttttaggcgtgtt
ctgcttcacattttagattgcacagaatgtgcaatagaacatttgctggaatctgcttcc
acttttcgtaagggttccaggttctccctagctgctgcttctttgcatgagctcaagcaa
ctctgttgtcagatgaaacaaaagccaatatcacaaatttatttccatggaaggcttgaa
gaagcaaaacttttaaaagctcaaggtcggcatgatatggctatcaatctcgcaagatat
attctacaaaaccactcaatgggagaagaaatgtccaatgtgtatcgattggttgggaag
tggttggctgaaactcggtctagcaattctagaattattttagagcagtacctgaaacat
tcggtggaactaacagagttaagcaaggatacagatgaaaaatatatatctaaacaatgt
cagacatactaccatctagcacactatacagatagtctgtttcagagctatgaagaaaga
ctagcctctagtgaatggcaagcagctttgcgattgagggaacacaagacaagagagttg
gatgcacttatcaaaagattaaaaagatcctcaaaaggcgaaaaaacagattactcagcc
aaaatacaagagttgcaaaaacaacttactatggatagggaagaggctgaaaaattgcat
gatgacagagacaacttcctcggcctcgctttgaaaggatatcagcgttgtcttctcata
ggtggaaaatatgacctgaaagtggtgtttcggctagtttcgttgtggttcaacttctat
tccagacagaatgttgtggaagagatgattagcacagtgaaggaggttcaatcatacaaa
tttataccattggtttatcagattgcttcaagacttggtagctctaaagatgggcaagga
tcaaccaattttcagatcgctttggtgtctctcattaggaaaatggcaattgatcatccg
tatcatactatttttcagcttcttgctttagcaaacggtgaccgtgtgaaagacaagcaa
aggagtagaaactcatttattgttgatatggataaaaaacttgcagctgaaaatctcctg
agtgagttatctacttatcatggtgctttgataggacagatgaaacaactagttgagatt
tatattaagcttgctgaattggagacaagaaaagaggaaacaaataagcgagtgccatta
ccaagagaaatccgtagtcttcagcagcttgaacttgtaccagttgtcacggccactgtt
cctgttgatcctagttgccaatatcgggaaggttcttttccgcattttcggagtctagct
gattctatcatggtaatgaatggcataaatgctcccaaagtggttgagtgccttggctca
gatggtcagatatatcgccaacttgcaaaatctggaaatgatgacctgcgacaggatgct
gttatggaacaattttttggtttggtaaacaacttcctgcagaatcatagagatacatgg
aaaagaaggctaagaatacgtacatacaaggtcgttccatttacaccaagtgctggtgta
cttgaatgggttgatcgtactattccgcttggtgaataccttttaggaagtgcaagaaac
ggaggagcacatggtcgatatggagtaggtgattggtcatttcttcgatgtagggagtgc
atgaccaacgagaaggacaagaggaaggcctttttgaaaatctgtgacaatttcaggcct
gttatgcactatttctttttggagaaattcttgcaacctgcagattggtttcagagcaga
ctgtcttatacaagaagtgttgcagctagttcaatggtaggttacattgtaggacttgga
gatcggcattcaatgaatattcttatcgatcaagaaacagctgaggtggtacacattgat
cttggtgttgcctttgagcagggacttatgcttaaaacaccggagagggttccttttaga
ctgaccagagacatcatagatggcatgggtgttaccggtgttgagggtgttttcagaaga
tgttgcgaagaaactctctccgtcatgagaacaaacaaggaagcactgctgactataatt
gaagttttcatccatgatcctctgtataaatgggctctctctcccttgaaagctttgcag
cggcagaaggaaactgatgatggtatagatgcatgtttggagagttcacaagatgcttgt
gaaggaaacaaagatgcagctcgtgctacactcagagttaaagaaaaattagatggctat
gaagcaggtgaaatcagaagtgtgcaggggcaggtccagcaactcatacaggatgcaata
gacatggaccgattgtgtcacatgtttccagggtgggcagcttggttgtga

DBGET integrated database retrieval system