KEGG   Musa acuminata (wild Malaysian banana): 103988716Help
Entry
103988716         CDS       T03447                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit pprA
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
KEGG Orthology (KO) [BR:mus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mus01009]
    103988716
Protein phosphatases and associated proteins [BR:mus01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103988716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-GeneID: 103988716
NCBI-ProteinID: XP_009405606
LinkDB All DBs
Position
6
AA seq 348 aa AA seqDB search
MEESLRRDADEPLGIGGGGGRPSAGEEQVAEEAELQGRCLDLTSFQLHDLSEVDIPDDLV
ELDLTTNRLSRLDPRVGLLSQLRKLSLRQNLFDDDGVEPISRWNVIAGLHELVLRDNKLR
KIPDVSIFKNLLVFDVSFNEISSLNGLSNVANTLKELYVSKNEVNKMEELEHLHSLQILE
LGSNRLRVMENLETLTNLQELWLGRNRIRMVTLCGLKCIRKISLQSNRLTSMMGFQECIA
LEELYLSHNGIQKMEGLSTLQNLRVLDISSNKLTAISDIEKLTRLEDLWLNDNQIPSLKG
IDLAVSGSREKLTTIYLERNPCATSSEYSTTLRQIFPNLQQLDSDIFM
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagccttcgtcgagacgccgatgaaccactggggatcggagggggaggagga
cggccgtcggcgggagaggaacaagtggccgaggaagcggagctgcaagggcgctgcctc
gacctcacgagctttcagctccacgacttgagcgaggtcgatatcccggacgacctcgtt
gagctggatctcaccaccaacaggctctcccgattggacccccgggtcggcctcctctcg
cagctgcggaagctctcgctgcggcagaaccttttcgacgatgatggcgtcgagcccatc
tcccggtggaatgtcatcgccggcttgcatgagctagtgcttcgggataacaagctcagg
aaaatacctgatgttagcattttcaagaaccttcttgtctttgatgtctcatttaatgag
atatcttccttaaatggcttgtccaatgtagcaaacacgctcaaagagctttatgtttca
aagaatgaagtcaacaagatggaggaacttgaacacttgcattcattgcagatccttgaa
cttggttcaaatagattaagggtaatggagaacttggaaacattgacaaatttacaggag
ctgtggcttgggcgaaatcgtattcggatggtcaccttgtgtgggttgaaatgcatcaga
aaaataagtttgcagagcaaccggttgacatccatgatgggttttcaggaatgcatcgcg
ctagaggaattgtatctgagtcataatggtattcagaagatggaaggactatccacctta
cagaaccttcgtgtattggacatctcatccaataaacttactgctattagtgatatcgaa
aagttgacgagattagaagacctatggcttaacgacaaccaaataccttctctgaaggga
atagatctagctgtatcgggttcaagggaaaagcttacaaccatttatcttgaacgcaat
ccatgtgctacctcatcagaatattctaccacactgaggcagatatttccaaatcttcag
cagcttgattcagatatttttatgtga

DBGET integrated database retrieval system