KEGG   Musa acuminata (wild Malaysian banana): 103990978Help
Entry
103990978         CDS       T03447                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00020  Citrate cycle (TCA cycle)
mus00190  Oxidative phosphorylation
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
mus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103990978
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103990978
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103990978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103990978
NCBI-ProteinID: XP_009408578
LinkDB All DBs
Position
7
AA seq 636 aa AA seqDB search
MWRRCLPRNFRFSRKASPIGSEPIRQSPWTAPRSFSTDSVGRSSYTIVDHTYDAVVVGAG
GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGS
DWLGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCA
CAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDSKGTCQGVIALNMEDGTLHRFHA
ANTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITE
GSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLN
HLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIEGDDP
DAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEICKPGEKQKPLEKDA
GEKTIAWLDKLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHD
VKIHDRSLIWNSDLIETVELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWLKH
TLGYWENGKVKLTYRPVHMNTLDDEVESFPPKARVY
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgccgctgcttgccgcggaacttccgcttctcgaggaaggcgtcgccgatcggg
agcgagccgatccgtcagtcgccgtggacggcgcctagatccttctccactgactcggtt
gggcgctcttcatatactatcgttgatcacacatatgatgcagtggttgtaggcgctgga
ggtgcagggctaagagcagccattggtctctcagagcatggctttaatactgcttgcatt
accaagctctttcctactcgctctcacacggttgctgcacagggtggtataaatgctgct
cttggtaatatgagcgaagatgactggaggtggcacatgtatgatactgttaaaggaagt
gactggttaggtgatcaggattccattcagtatatgtgcagagaagcaccaaaagcagtc
attgaactggaaaactacggattacctttttccaggactgaagatggcaaaatatatcaa
cgggcttttggaggtcaaagtttggattttggaaaaggtggccaggcatatcgttgtgca
tgtgctgctgatcgaactggccatgccttgctgcacacactttatgggcaagcgatgaag
cataatactcagttttttgttgaatactttgctttggatcttctcatggatagcaaaggg
acttgccaaggtgtgattgcactgaatatggaggatgggacccttcatcgtttccatgca
gccaacacaattttagctactgggggctatggtagagcttacttctctgcaacctcagct
catacatgtactggagatggcaatgctatggtcgcacgagctgggttacctctcgaggac
cttgagttcgttcaatttcaccctacaggcatatatggtgctggatgcctgatcactgaa
ggatctcggggcgagggtggtatccttaggaacagtgaaggtgaacgtttcatggaacga
tatgctcctacagcaaaggatcttgcatcacgcgatgtggtttctagatctatgacaatg
gaaataagagaaggtcgtggtgtagggccacttaaggatcacatttatcttcatctgaat
catttacctccggatgttctcaaggaaagacttcctgggatatctgagactgctgctatt
tttgctggtgttgatgtcactaaggaacccatccctgttctgcctaccgtgcactataat
atgggtggaataccgacaaactaccatggcgaggtagttcatatagagggtgatgatcca
gatgcagtggttcctggtttgatggctgctggagaggcagcttgtgcatctgtccatgga
gcaaataggcttggcgcaaactcacttcttgatattgttgtttttggcagagcctgtgca
aacagagtcgcggaaatctgcaagccaggggagaagcagaaaccacttgagaaagatgct
ggagaaaagaccattgcttggctggataagttaaggaactcaaatggttcactgccaact
tcaaaaattcgtctaaacatgcaacgggtgatgcaaaataatgctgctgtgtttcgaaca
caagaaacactagaagaaggttgtcagttgatagacaaagcatgggagagctttcatgat
gtcaaaatccatgatcggagtctgatatggaactccgacttaatagagactgttgagcta
gaaaatcttttaataaatgcatgtataacaatgcactcagctgaggcaagaaaggaaagt
cgaggagctcatgctcgcgaagactttacgaaaagagatgatgagaagtggctgaaacac
acactagggtattgggagaatgggaaagtcaagctaacctataggcctgtccatatgaac
actttggatgatgaagtggagtcattcccaccgaaagcacgggtttactaa

DBGET integrated database retrieval system