KEGG   Musa acuminata (wild Malaysian banana): 103991922Help
Entry
103991922         CDS       T03447                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00630  Glyoxylate and dicarboxylate metabolism
mus00710  Carbon fixation in photosynthetic organisms
mus01100  Metabolic pathways
mus01200  Carbon metabolism
Module
mus_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mus_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mus_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103991922
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103991922
Enzymes [BR:mus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     103991922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 103991922
NCBI-ProteinID: XP_009409740
UniProt: M0THX7
LinkDB All DBs
Position
7
AA seq 175 aa AA seqDB search
MSAAFLSAGAVAGYVGLRADASAKLFPEKDCSIGWRSRTVSNGFRTRCMKTWNPFNNNKY
EALSYLPPLSKESIAKEVDYMIAKGYIPCLEFDEVGQVHRTNSRIPGYYDGRYWTLWKLP
MFGCTDPSLVLEEIEECKQVYPNAYIRLLSFDSQRQCQCMSFVIQKPTSATVANA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgcgttcctttctgctggggcggtcgccggctacgtcggcctgagggctgat
gcttcagctaagctttttccagagaaagactgctccattgggtggcgatcgaggaccgtc
tccaatggcttcagaactcggtgcatgaagacatggaacccattcaataacaacaagtac
gaggcgctttcttacctgccacccctctccaaggaatcaatagcaaaggaggttgattac
atgatagctaaaggatatatcccctgcttggaatttgatgaggtgggacaagtgcacagg
accaatagccgaataccgggctactacgacggaaggtattggacactctggaagctacca
atgttcggatgcacggacccatccctagtccttgaggagatcgaagaatgtaagcaggtt
tatcctaatgcttacattcgcctcctgtccttcgacagccagcgacagtgccagtgcatg
tcatttgtcatccagaaacccacatccgccactgttgctaatgcctaa

DBGET integrated database retrieval system