KEGG   Musa acuminata (wild Malaysian banana): 103995163Help
Entry
103995163         CDS       T03447                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1-like isoform X1
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103995163
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mus03036]
    103995163
Enzymes [BR:mus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103995163
Chromosome and associated proteins [BR:mus03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103995163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 103995163
NCBI-ProteinID: XP_009413963
LinkDB All DBs
Position
8
AA seq 779 aa AA seqDB search
MRRGNRATKPRSQTSRCTRRRERCEQEEPRPPEVCEDCCISTRSLRSLTLLLVVIASSVL
FAMERHSNCTPSSSENGVLDVKPLRSLAPMFPAPFGFNAITQSIVPPFICVTPFGSSPAG
SDSSYPSGVPPAFPPFSFHEAPNQKPSNPDPVSFATRVVDAHVAMTPGANGSLRASPFST
SAKTPTSGTFWTPSATNVSIDEDEDPSLDDNMPASGRKTKRAGRRSSNQAGSSGTDVKRK
RPNKSLNTELPLLSSSSNHPRESVEIVLMTYDALRRRLLQLDEAKDVNRRQDLKAGAIMS
GKDLKANAGKRIGLVPGVEIGDIFYFRFEMCLIGLHAPSMAGIDYMTASFSDKDEPVAIC
IVSAGGYENEDDDVDVLIYSGQGGSGKHDKKQPDDQKLERGNLALERSLHRKNQIRVVRS
TKDVSCPTGKIYIYDGLYKIDDSWVEKGKTGFNIFKYKLLREPGQPDGIVVWKMIQKWKE
NPSSRGRVILPDISSGAENIPVCLINDVDDERGPNHFVYVTTVKHLCHTISKKPLEGCMC
LSVCLPGDTNCFCAQQNDGDLPYNSMGLLVRRKPLIYECSVSCQCSFNCRNRVTQKGIRL
HFEVFRTKDRGWGLRSWDPIRAGTFICEYAGEVISKTRVEDDGEEDEYIFQATYLGEKAS
RWNCGPELLEDPDINNSNEVFRPFPITISAKNSGNIARFMNHSCSPNVFWQPVLYDHGDE
DYPHIMFFAIKHIPPMTELTYDYGLHGDEAGQQKIGTGFISQRAKKCLCGSPNCQGYFG
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggggaaccgagcgaccaaaccccgctcccagacctccaggtgcacaaggcga
agagagagatgcgagcaagaggagccgagaccgcccgaggtctgtgaggattgctgcatc
tctacccgtagcctacgatccttgaccttgctactggttgttatcgcttccagtgttttg
tttgccatggaaaggcattccaattgcactccttcgtccagtgaaaatggggtcttggat
gtgaaaccactacgatctttggctccgatgttccctgcaccattcggcttcaatgctatt
acacagtcaattgtcccaccctttatttgtgtcaccccctttggctcatcccctgctggc
tctgattcatcatatccttcaggagtcccaccggcgttcccccctttcagctttcacgaa
gctcccaaccaaaagccatcaaaccctgaccctgtctcttttgctactcgtgttgtagat
gctcatgttgcaatgacgcctggtgctaatggctctctgcgggcctctccattctccact
tctgccaagacaccaacctccggtacattttggacaccatcagcgaccaatgtttccata
gatgaggatgaggacccttctcttgatgacaatatgccagcatcaggcagaaagactaag
agggcaggacgccgaagtagcaaccaggcgggcagctcagggacagatgtcaagcgcaaa
cgacctaataagagtctgaacactgagcttcccctattgtcctcttcatcaaaccacccc
agggagtctgtggagattgtcctcatgacctatgatgcacttcgtaggaggcttctgcag
ttggatgaagcaaaagatgtaaacaggcgccaagatctgaaggctggggccatcatgtct
ggtaaggatctcaaggctaatgcaggaaagaggatcggacttgtcccaggagttgaaatt
ggggatattttctattttaggtttgagatgtgcttgattggattgcatgctcctagtatg
gccggtattgattacatgacagctagtttttctgacaaagatgagcctgttgccatttgt
attgtctcggctggtggttatgagaatgaagatgatgatgtcgatgttttaatttacagc
ggccagggaggtagtggtaagcatgataagaagcaaccagatgaccagaaactggaaagg
ggtaaccttgctctcgaaagaagcttgcacaggaagaatcagatccgggttgtacgtagt
accaaagatgttagctgtccaactggcaaaatatacatctatgatggtctttataagatt
gatgactcatgggtcgagaaaggtaagacaggattcaatattttcaagtacaagttgctg
agagaaccagggcagcctgatggaattgtggtatggaaaatgatccagaaatggaaagag
aacccatcatctagaggcagagtcatactgcctgacatatcatcaggtgcagaaaacata
cctgtttgccttatcaatgatgttgatgatgagagaggtccaaaccattttgtatatgta
accaccgttaaacatttgtgtcatactatctcaaagaagcctttagagggttgcatgtgc
cttagtgtgtgtctccctggtgataccaactgcttttgtgcacaacaaaatgatggtgat
ttaccatataattcgatggggcttcttgtgagacggaagcctctgatttatgagtgcagt
gtttcttgtcaatgctcttttaattgccgaaatagggtgacccaaaagggaattaggctc
cactttgaagttttcaggacaaaggaccggggttggggtctacgttcctgggaccctatc
agggcaggtacattcatttgtgaatatgcaggcgaggttatcagtaaaaccagagttgaa
gatgatggtgaagaagatgagtatatttttcaagcgacatatcttggtgagaaagcttcc
agatggaattgtgggcctgagttactagaagatccagatataaataactcaaatgaggtg
tttagaccatttcctattacgataagtgcaaagaattcaggaaacatagcacgttttatg
aatcatagctgctcgcctaatgtcttttggcaaccagttctatatgatcatggtgatgaa
gattatccacatataatgttctttgcaatcaaacacattcctcccatgactgaactgaca
tatgattatggtctgcatggagatgaagctggtcaacagaaaattggaactggctttata
tcgcagagagctaagaagtgcctgtgtggatctccaaattgtcaaggctattttggctaa

DBGET integrated database retrieval system