KEGG   Mycolicibacterium vanbaalenii: Mvan_0024Help
Entry
Mvan_0024         CDS       T00449                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mva  Mycolicibacterium vanbaalenii
Brite
KEGG Orthology (KO) [BR:mva00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mva01001]
    Mvan_0024
Enzymes [BR:mva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Mvan_0024
Protein kinases [BR:mva01001]
 Serine/threonine kinases: Other
  Bacterial family
   Mvan_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Haspin_kinase Kinase-like RIO1
Motif
Other DBs
NCBI-ProteinID: ABM10875
UniProt: A1T125
LinkDB All DBs
Position
complement(28479..29771)
Genome map
AA seq 430 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEGVDSRLGRRVAIKVLKAEYSTDAEFVERFRA
EARTVAMLNHPGIAGVYDYGETDIDGEGRTAYLVMELVNGEPLNSVIKRTGRLSLRHALD
MLEQTGRALQVAHSAGLVHRDVKPGNILITPTGQVKLTDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDATAASDVYSLGVVGYEAVSGKRPFIGDGALTVAMKHIKETPPPLPAD
LPPNVRELIEITLVKNPGMRYKSGGPFADAVAAVRAGRRPPRPNAAPSIGRAAPTAVPPA
IASRPAADPTGRAPAPTSRTRATGSHHRSAPPPRGGFSSGQRALLWAAGVLGALAIVIAI
LIVLNAQDRKDQPPPTTVTETPTSQGAPPETPGAAAPAFGDHEPDRYWVLRPVDNLSPLT
TRHVSEQNLR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaagagtcggtgtcacgctgtctgggcggtaccggctgcagcggctgatcgcc
accggcggcatgggtcaggtctgggaaggcgtggactcgcggctgggccgccgggtcgcg
atcaaggtgctcaaggccgagtattcgaccgacgcggagttcgtcgagcggttccgcgcc
gaggcccgcaccgtcgcgatgctcaaccatccgggcatcgccggggtgtacgactacggc
gagaccgacatcgacggcgaaggccgcacggcctatctcgtgatggaactcgtcaacggc
gaaccgctgaactcggtgatcaaacgcaccgggcggctgtcgctgcgccacgcgctggac
atgctcgagcagaccggacgggcgttgcaggtggcacactccgccgggttggtgcaccgc
gacgtcaagcccggcaacatcctcatcacgccgaccggtcaggtgaagctcaccgacttc
ggcatcgccaaggcggtcgacgcggccccggtgacccagaccggcatggtgatgggcacc
gcgcagtacatcgcccccgagcaggccctcggccacgacgccaccgcggccagcgacgtc
tactcgctgggtgtggtcgggtacgaggccgtgtccggtaagcgcccgttcatcggcgac
ggcgcattgaccgtcgcgatgaagcacatcaaggagactcctcccccgctgcccgcggat
cttccgcccaacgtgcgcgagctcatcgagatcacgctcgtcaagaacccgggcatgcgc
tacaagtccggcgggccgttcgccgacgcggtcgccgccgtccgcgcggggcggcgcccg
cccaggcccaacgcggcgccgtcgatcggacgcgccgcaccgaccgcggtgcccccggcg
attgcgtcccgcccggcagccgaccccaccggccgcgctccggccccgacgtcgcgcacc
cgtgccacgggcagccaccaccgctcggccccgcccccgcgcggggggttctcgtccggg
cagcgggccctgctgtgggcggccggggtgctcggcgcgctggcgatcgtcatcgcgatc
ctgatcgtgttgaacgcccaggaccgtaaggaccaaccgccgccgaccaccgtcaccgag
acgccgaccagccagggcgcgccaccggagacccccggcgcggccgcgcccgcattcggc
gatcatgaacctgaccgatattgggtattacggcccgttgacaacctgtcacccctgacg
acacggcacgtttcagaacagaatttgcgatga

DBGET integrated database retrieval system