KEGG   Mycolicibacterium vanbaalenii: Mvan_0463
Entry
Mvan_0463         CDS       T00449                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, alpha subunit
  KO
K18251  phthalate 3,4-dioxygenase subunit alpha [EC:1.14.12.-]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00624  Polycyclic aromatic hydrocarbon degradation
mva01100  Metabolic pathways
mva01120  Microbial metabolism in diverse environments
mva01220  Degradation of aromatic compounds
Module
mva_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mvan_0463
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mvan_0463
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABM11310
UniProt: A1T2B0
LinkDB
Position
505224..506678
AA seq 484 aa
MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHESEIPQPGDYVVRQVL
QDSFIIARDSAGEVRVMFNMCLHRGMQVCRAEMGNASNFRCPYHGWSYRNDGRIIGLPFH
QEAYGGDAGFNKTGQTLLPAPSVASYNGLIFLSMDPDAESLEDYLGDFRFYLDFYTRQGP
NGLEVQGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIGLFREPKAHKRKDGATYWA
GRGGGTTYKLPEGSFEDRMSYVGYPAEMISRAKATWTEQQRQVVGADGFMISAATCFPNI
SFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAVDSDAPEAFKAASYKAYLMCF
GSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLADDARVVDTLSSAQFHGPGYAQ
LGYNENNQRQLLRLWADYLDMPPLRVDPATVLTDNPQGIEPMVQTNGGAVAGIDSESATT
SVTL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgcaggatcacggtgaggtgttggcggctgtacgcactggcatgattccggcgcacgtg
tataacgacaagcagattttctcgctcgaaaaggagcggctgttcagtcgggcgtggttg
ttcgtggcgcacgagtcggagattccgcagccgggggactacgtggtcaggcaagtgtta
caggattcgttcatcatcgctcgtgattctgcaggcgaggtccgggtgatgttcaatatg
tgcctccatcgcggtatgcaggtttgtcgggcggagatggggaacgcgtcgaatttcaga
tgcccgtaccacgggtggtcttaccgcaacgacggccgcattatcggactgccttttcac
caagaggcctatggaggagacgcggggtttaacaagacgggtcagaccctgttgccagcg
ccgagtgtggccagctacaacgggttgatctttctgtcgatggatcctgacgcagaatcg
cttgaagactacctgggtgatttcaggttctatctcgatttctacaccaggcagggcccc
aacggtctcgaggtgcaaggtcctcagcgttggcgggtaaaagcgaactggaagatcgca
gctgagaatttcgccggggacatgtaccacaccccgcagacgcacacgtcggtggtcgag
atcggcctgttccgagagccgaaggcccacaagcgcaaagacggcgcaacgtattgggcg
ggcagaggtgggggcaccacatacaagctgccggaggggagtttcgaagaccggatgagc
tatgtcggctacccggcggagatgatcagtcgtgccaaggccacctggaccgagcagcag
cgacaggtcgtgggcgccgacgggttcatgatctcggcggcgacgtgctttccgaacatc
agtttcgtgcacaactggccgaaagtggaggacggcgagcacgtcttgccgttcatttcg
attcgggtatggcagcccattagcgagaacgagactgaggtgctgtcctggtttgcggtg
gattcggatgccccggaagcgtttaaggcggcctcatacaaggcttatttgatgtgtttc
ggctcgacgggaatgttcgaacaagacgatgtcgagaactgggtgtcgctgaccaacacc
gcggggggttccatggcccgccgactgcggctgaacagccggatggggctgctcgcagac
gatgcccgggtggtcgacaccctaagcagcgctcaattccacgggcctggatacgctcag
ctcggctacaacgagaacaatcaacggcaattgttgaggctctgggccgactacctcgac
atgccgccgctgcgagtcgacccggctactgtgctcacggacaacccgcaaggtattgag
ccgatggtgcagaccaacggcggggccgtcgccggtatcgactcggagtcggctacgacg
tcggtgacgctgtga

DBGET integrated database retrieval system