KEGG   Mycolicibacterium vanbaalenii: Mvan_0464
Entry
Mvan_0464         CDS       T00449                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, beta subunit
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00624  Polycyclic aromatic hydrocarbon degradation
mva01100  Metabolic pathways
mva01120  Microbial metabolism in diverse environments
mva01220  Degradation of aromatic compounds
Module
mva_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mvan_0464
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mvan_0464
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: ABM11311
UniProt: A1T2B1
LinkDB
Position
506675..507271
AA seq 198 aa
MTVDDQRTGRPMAPSVLGAHAARAQRVGDPLPFDDSRHLEAHRFLVNEAYLLDAQDYDRW
LGVLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSLERRVARFATEHAWTEDPPSR
LRHFITNVRTFLTDDADHLVVDSAELLFRSRGDVNESTLLSCGREDLLRRDGNALKLARR
TICVDESVLRMQNLAVFL
NT seq 597 nt   +upstreamnt  +downstreamnt
gtgaccgtcgacgatcaacgcactggtcgacccatggccccatcggtactcggtgcgcac
gccgcgcgcgcccaacgcgtcggcgacccgttaccgttcgacgattctcgccatctggag
gcgcatcgcttcctcgtcaacgaggcgtacctcctcgatgcccaagactacgacaggtgg
ctgggtgtgctcacagaggacattcactattacatgccggtgcggatcaccaccgccgcc
ggcgccggattcgatagctcaccgggaatggcgcatttcgacgagaacaaatactcactt
gagcgccgggttgcccgtttcgccaccgagcatgcctggactgaggatccgccgtcgcgc
ctgcgccacttcatcaccaacgtgcgcacattcctcaccgacgacgccgaccacctcgtg
gtcgacagcgctgagttgttgttccgcagccgcggcgacgtcaatgagtccacgctcctc
tcatgcggtcgtgaggatctcctacgtcgcgatggcaacgccctcaaactcgcacgccga
acaatctgcgtcgatgaatcagtgcttcgaatgcagaatctggcggtcttcctatga

DBGET integrated database retrieval system