KEGG   Mycolicibacterium vanbaalenii: Mvan_0467
Entry
Mvan_0467         CDS       T00449                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, ferredoxin reductase subunit
  KO
K18254  phthalate 3,4-dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00624  Polycyclic aromatic hydrocarbon degradation
mva01100  Metabolic pathways
mva01120  Microbial metabolism in diverse environments
mva01220  Degradation of aromatic compounds
Module
mva_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mvan_0467
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Mvan_0467
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Reductase_C 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_8 XdhC_C DAO Pyr_redox_3 3HCDH_N UDPG_MGDP_dh_N NAD_binding_7 K_oxygenase GIDA AdoHcyase_NAD Lycopene_cycl
Other DBs
NCBI-ProteinID: ABM11314
UniProt: A1T2B4
LinkDB
Position
508434..509840
AA seq 468 aa
MSGLRELCRCGRGLLRHRRSGTRGGPQDGGSFRGQDPGRGGCAQLSGGRVGSRRRMTSRV
VIVGSSVGGVRTAQALRSQGYDGDIVLVGEETALPYDKPPLSKALLAGTSDIAAATLLTR
DAAAADAIELLLGRRAIGVDVAACQVEFADDEPLRYDHLVVATGASARPSPWGHGSGVHV
LRTLEDCLRLRADLVAGARLVVIGAGFIGAEVASTARSLGLQVTVVDPVPVPMSRVLTEE
IGGWFVDLHRDHGVHTRFGVGVENIEGERGNLKIGLTDGTVLEADTVVVGIGAVPNDGWL
MPSGLVVDDGLVCDEFCRAVTSQNIYAVGDVSRWFHRARGVTMRIEHWTNAVDQASCVAH
NILYPDELRCYEPVEYVWSDQYDWKIQFCGQTTHLGEPLVVGDRLSDNRFTALYPDREQR
LSGAAIVNWPRALIECRRALKAGSDLETVRERLELLTNPPDTAATRSP
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtcagggctacgcgaactgtgtcgttgcggccgaggattacttcgacatcgacgatcg
gggactcgtggaggtccgcaagacggaggttccttccgcggacaggacccgggtcgagga
ggctgcgcgcagctgtccggtggccgcgttggaagtcgtagacgaatgacgtcacgggtc
gtcatcgtcggcagttctgtcggcggggtccgcacggcccaggcgctgcgctcgcaaggc
tacgacggcgacatcgtcctggtgggcgaggaaactgcgctgccctacgacaaaccgccg
ctatccaaagcgttgcttgcgggtacgagtgacatcgcggctgcgacgttactcaccaga
gacgctgccgccgccgacgccatcgagcttctcctcggccgccgcgcgatcggagtggat
gtcgcagcgtgtcaggtcgagttcgccgatgatgagcccctgcgttatgaccacctggtg
gtggccaccggagccagcgcgcgaccatccccgtggggccacggatcgggcgttcatgtg
ctccgcactctggaggactgtctgcggctaagagccgacctcgttgccggtgcccgcctc
gtggtgatcggggcaggatttattggggccgaggtcgcgtcaaccgcgcggtcactgggg
ctgcaagtgacggttgtcgacccggtgccggtgccgatgagccgggtgctgaccgaagag
atcggtgggtggttcgtcgatttgcaccgagaccacggagtgcacacgcgattcggcgtc
ggtgtcgagaatattgagggggagcgcggcaaccttaagatcggcctcacggacgggacc
gtcctagaagccgacacggtggtggtgggcatcggcgccgttccgaatgacggctggctg
atgccgtcgggactggtcgtcgatgacggcctggtctgcgacgagttctgccgcgccgtc
acgtcacaaaacatctacgcagtcggcgacgtgtcgcgttggtttcatcgcgcccgcggc
gtgacgatgcgcatcgaacactggacaaacgcggtcgaccaggcgtcttgcgtcgcgcat
aatattttgtatcccgatgaattgcgctgctacgagcccgtcgagtacgtctggagcgac
cagtacgactggaagatccagttttgcggccaaacaactcacctaggagagccactcgtc
gtcggagatcgattgtccgacaatcgattcacagcgctctaccccgatcgcgagcaacgt
ttgagcggcgccgcgatcgtgaactggcctcgagcactgatcgagtgcaggcgtgcactg
aaggccggcagcgatctcgaaactgtgcgggagaggctcgaactgttaacgaacccaccc
gataccgccgcaacgcgatcaccatag

DBGET integrated database retrieval system