KEGG   Mycolicibacterium vanbaalenii: Mvan_1484Help
Entry
Mvan_1484         CDS       T00449                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00473  D-Alanine metabolism
mva01100  Metabolic pathways
mva01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mvan_1484
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Mvan_1484
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mva01011]
    Mvan_1484
Enzymes [BR:mva01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Mvan_1484
Peptidoglycan biosynthesis and degradation proteins [BR:mva01011]
 Precursor biosynthesis
  Racemase
   Mvan_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABM12316
UniProt: A1T566
LinkDB All DBs
Position
1576055..1577227
Genome map
AA seq 390 aa AA seqDB search
MTTTPTMTQKLPQALPTASIDLDAIAHNVAVLREHAGPAAVMAVVKADGYGHGATQVARA
ALAAGAAELGVATVGEALALRRDGVTARVLAWLHPPGTDFAPALLADVDVAVSSLRQFTD
LLDAAGRTGRTADVTVKADTGLSRNGVGEADYPALVDALRRAASDGAVRVRGLMSHLAHG
DDPEHPFNDVQARRLTEMAKLAGARGVSYDVVHLSNSPAALTRPDLAFDMVRPGIAVYGQ
TPIPQRGDFGLRPAMTVKCPVSAVRPVRAGDAVSYGHTWTAQTDTTLALVPAGYADGVFR
ALSNRFEVSINGRRYPNVGRICMDQFVVDLGPGPVDVAEGDDAILFGPGTDGEPTAQDWA
ELLDTINYEVVTSPRGRIVRTYVGGKGGPQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccacgccgactatgactcagaaactgccccaggctctgcccaccgcgtcgatc
gaccttgacgccatcgcccacaacgtcgctgtactgcgcgaacacgccggtccagctgcg
gtgatggcggtggtgaaggccgacggttacggccacggcgcgacgcaggtggcgcgtgcc
gcgctggcggccggggcggccgaactcggtgtggccaccgtcggggaggcgttggctctg
cgccgcgacggcgtcaccgcccgggtgctggcctggctgcatccgccgggcaccgatttc
gcgcccgcgctgctggccgacgtcgacgtggcggtgtcgtcgctgcggcagttcaccgac
ctgctggacgcggcgggacgcaccgggcgcaccgccgacgtcacggtcaaggccgacacc
gggctgagtcgcaacggggtcggcgaggccgactacccggccctggtggatgcgttgcgg
cgcgctgcgagcgacggcgcggtgcgggtgcgagggttgatgtcgcacctggcgcatggt
gacgaccccgagcaccccttcaacgatgtgcaggcgcgccggctgaccgagatggcgaaa
ctggccggtgcccgcggcgtcagctacgacgtcgtgcacctgagcaattcaccggcggcg
ttgacccggccggacctggcgttcgacatggtccggcccggcatcgcggtgtacgggcag
acccccatcccgcagcgcggcgatttcgggctgcgcccggcgatgacggtgaaatgcccg
gtctccgcggtccgtccggtccgcgccggcgatgcggtgtcctacgggcacacctggacc
gcgcagaccgacacgacgctggcgctggtgcccgccggatacgccgacggggtgttccgc
gcgctgagcaatcgcttcgaggtgtcgatcaacggccgccggtaccccaacgtcggtcgg
atctgcatggaccagttcgtggtggacctgggtccgggaccggtggacgtcgccgagggc
gacgacgcgattctgttcgggccgggcaccgacggggagccgaccgcgcaggactgggcg
gagctgctcgacaccatcaactacgaggtggtgacgagcccgcggggccggatcgtgcgg
acctacgtgggcggcaagggcggaccgcagtga

DBGET integrated database retrieval system