KEGG   Mycolicibacterium vanbaalenii: Mvan_2143Help
Entry
Mvan_2143         CDS       T00449                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00473  D-Alanine metabolism
mva00550  Peptidoglycan biosynthesis
mva01100  Metabolic pathways
mva01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mvan_2143
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mvan_2143
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Mvan_2143
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mva01011]
    Mvan_2143
Enzymes [BR:mva01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mvan_2143
Peptidoglycan biosynthesis and degradation proteins [BR:mva01011]
 Precursor biosynthesis
  Amino acid ligase
   Mvan_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABM12958
UniProt: A1T708
LinkDB All DBs
Position
2287954..2289057
Genome map
AA seq 367 aa AA seqDB search
MTARIRVAVVYGGRSSEHAISCVSAGSILRNLDPQRFEVVPVGITPEGSWVLTDGRPETL
AITDGALPGVSGSSGTELALAADPGRRGQLLSLGDAAGDVLAAVDVVFPVLHGPYGEDGT
IQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLTAAGLPVGDHVVLRPREATVSLEDRER
LGLPVFVKPSRGGSSIGVSRVTAWDALPAAIELARRHDPKVIVEAAIPGRELECGVLEFP
DGHLEASTVGEIRVAGVRGREDGFYDFETKYLDDGAELDVPAKVDDAIAEAVRGLAIRAF
DAIDCQGLARVDFFLTDAGPVINEINTMPGFTTISMYPRMWAASGIDYPTLLATMVETAI
ARGTGLR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcccgcatccgagtcgccgtcgtctacggcggacgaagctccgaacacgcgatc
tcgtgtgtttccgcaggcagcatcctgcgcaacctcgacccgcagcggttcgaggtggtc
cctgtcggcatcacccccgagggctcgtgggtgctcaccgacgggcggcccgagaccctg
gcgatcaccgacggtgctctgccgggtgtcagcggatcctccggcaccgaactcgcgctg
gccgccgatccgggccgacgcggccaactcttgtcgctgggggacgccgcaggggatgtg
ctcgccgccgtcgacgtggtgttccccgtcctgcacggcccctacggtgaggacggcacg
atccagggcctgctcgagttggccggtgtcccatacgtgggggcgggggtgttggccagt
gccgccggcatggacaaggagttcaccaagaagttgctcaccgcggccgggctaccggtc
ggtgaccatgtcgtcctgcggccgcgcgaggccaccgtgtcgctggaagaccgggaacgg
ttggggctgccggtgttcgtcaagccgtcccgaggtgggtcgtcgatcggcgtgagtcgt
gtgacggcgtgggacgcgttgcccgccgccatcgaattggctcggcggcacgatcccaag
gtcatcgtcgaggcggcgattccgggccgcgagctggagtgcggcgtgctggagttcccc
gacggccacctcgaagccagcacggtgggggagatccgggtggccggtgtgcgcgggcgc
gaggacggcttctacgacttcgagaccaagtacctcgacgacggtgccgaactcgacgtt
cccgccaaggttgacgacgctatcgccgaagcggtccgggggttggccatccgtgcgttc
gacgcgatcgactgccagggcctggcgcgggttgacttcttcctcaccgacgccggaccc
gtcatcaacgagatcaacaccatgccgggattcaccacgatctcgatgtatccccggatg
tgggcggccagcggcatcgactaccccacgcttctggcgacgatggtcgagacggctatc
gcacgaggcaccggcctgcgctaa

DBGET integrated database retrieval system