KEGG   Mycolicibacterium vanbaalenii: Mvan_3027Help
Entry
Mvan_3027         CDS       T00449                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
mva  Mycolicibacterium vanbaalenii
Brite
KEGG Orthology (KO) [BR:mva00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mvan_3027
Enzymes [BR:mva01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Mvan_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ABM13830
UniProt: A1T9I0
LinkDB All DBs
Position
3192057..3193277
Genome map
AA seq 406 aa AA seqDB search
MADENGRRDSAHTLGAMITRALPIVFAMVLALTACGESVDTTQTTGSRNPAVTAPATTMA
AEVTDRLDDAVERVMTEAGIPGAIVGIWGPGGDYVRAFGVADTKTRAPMKTDFYSRIGSL
TKTFTVTAVLLLADQGRLGLDDPIAGYVDGVPGGDAITLRQLARMQSGLPDYTANPEFVP
TVIADPGRAFAPTEMLEFAFSQPPMFAPGDGYHYSNTNTVLLGLVVEKVSGQSLGDYIRR
HISAPLGMAETSFPTDATFPGPHATGYTVQPPDDREMTATDWNLSWSWAAGNMVSTLHDL
RIWAPALVTGTLLSRQMQQQRLQMVESSGQPAPEEYGLGMFNVAGWIGHNGSVPGYQTVS
VYLPERQTALVILTNTDIAFRGAEPGTLLARAVTTELTPDHVYTLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtggcggatgagaacgggcgccgcgattcggcacatacgctgggtgcgatgatcacccgc
gctctgccgatcgtgttcgccatggtgctggcactcaccgcgtgcggggagtccgtggac
accacgcagaccaccggctcccggaacccggctgtcaccgcgccggccacgacgatggca
gccgaggtgaccgaccgtctcgatgatgcggtcgagcgggtgatgaccgaggccggcatt
cccggtgccatcgtcgggatctggggcccgggcggcgactatgtgcgcgcgttcggcgtg
gccgacacgaagacccgggcaccgatgaagaccgacttctacagccggatcggaagtctg
acaaagactttcaccgtcaccgcggtgctgctgctggccgatcagggccgactcggcctc
gacgacccgatcgccggatacgtcgacggcgtgcccggcggcgacgccatcaccttgcgc
cagctcgcgcgcatgcagagcgggctgcccgactacacggcgaacccggagttcgtgccg
acggttatcgccgatccggggcgggccttcgcgccgacggaaatgctcgagttcgccttc
tcgcagcccccgatgttcgcccccggcgacggataccactacagcaacaccaacaccgtt
ctgctcggtctggtggtggagaaggtcagcggacagtcactcggtgattacatccgccgt
cacatcagcgcgccgctcggaatggcggagacgagcttccccaccgacgccaccttcccc
gggccccatgccaccggctacaccgtccagccccccgacgaccgggagatgaccgccacc
gactggaacctgtcctggtcgtgggccgccggcaacatggtctccacgctgcacgacctg
cgcatctgggccccggccctggtgaccgggacgttgctctcccggcagatgcagcagcag
cggctgcagatggtcgaaagctcggggcagcccgcaccggaggagtacggactcggcatg
ttcaacgtcgccggctggatcggccacaacggcagcgtgcccggctaccagaccgtctcg
gtgtacctgccggagcggcagaccgcgctggtcatcctgaccaacaccgacatcgcgttc
cggggcgccgagccggggaccctgctggccagggcggtcaccaccgagttgacccccgac
cacgtgtacacgctcagctga

DBGET integrated database retrieval system