KEGG   Mycolicibacterium vanbaalenii: Mvan_3127Help
Entry
Mvan_3127         CDS       T00449                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
mva  Mycolicibacterium vanbaalenii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABM13929
UniProt: A1T9S9
LinkDB All DBs
Position
complement(3317131..3318861)
Genome map
AA seq 576 aa AA seqDB search
MAPSEATIPAVLADRAQQQPDDIAYTFVDYEADPAGISESLTWSEVHERVQIVAEKLSKI
GSPGDRAVILAPQSLEYVIGFLGAIQAGFIAVPLSMPQTRHHDERVTGAMKDSTPVVVLT
TSAVVDEVRKYGQADPKARPPKFLEVDTLDFDSPPKPAPQVPLPKTAYLQYTSGSTRQPA
GVVVTHKNVIVNLEQLLTDYYEACPGGAPEDTTVVTWLPFYHDMGLIVGVFIPMMLGRPA
VQMSPVAFMQKPARWMQQLGSHPSAFTAAPNFAFELAVKRTTDEDLAGKDLSTVKVMING
AERVHGATVRRFNERFAAFGLADSAMRPSYGLAEATVYVVASAGGRPPTAVRFDYEKLAA
GHAERCDDDGGAELIGCGVPRSTTVRVVDPDSLVENPAGKIGEVWLHGDHVAAGYWHNPK
LSELFAAQLGEPSAGTPKGPWLRTGDLGVMFDDELYIIGRIKDLLIVDGRNHYPDDIEAT
VAEFTGGRVAAISVPDEASEKLIVIAELKKQADPALLESVKQQVTAAISQTHSVRLSDFV
LVAPGSLPLTTSGKVRRASCVELYRNDKFSRLDATT
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtctgaagccacgatccctgcggtcctcgccgaccgcgcgcagcagcagccc
gacgacatcgcgtacaccttcgtcgactacgaagccgacccggccggaatctcggagagc
ctgacctggtcggaggtgcacgagcgcgtccagatcgttgccgagaagctctcgaagatc
ggctcaccaggggaccgggccgtgatcctggccccgcagagcctggagtacgtcatcggt
ttcctgggcgcgatccaggcgggcttcatcgccgtgccgctctcgatgccgcagacacgt
caccacgacgagcgggtgaccggcgcgatgaaggattcgacccccgtcgtggtgctgacc
acctcggcggtcgtcgacgaggtccgcaagtacgggcaggccgaccccaaggcgcggccg
ccgaaattcctcgaggtcgacacgctcgatttcgactcgcctcccaagccggcgccgcag
gtgccgttgcccaagaccgcgtacctgcagtacacgtcgggttcgacccggcagccggca
ggcgtggtggtcacccacaagaacgtcatcgtgaacctcgagcagctgctcaccgactat
tacgaggcgtgccccggcggtgcgcccgaggacaccaccgtcgtgacgtggttgcccttc
taccacgacatgggcctgatcgtcggcgtcttcatcccgatgatgctgggccgccccgcg
gtgcagatgagcccggtcgcgttcatgcagaagccggcccgctggatgcagcagctggga
tcacacccgagtgcattcaccgcggcgccgaacttcgcgttcgagctcgccgtcaaacgc
accaccgacgaggatctcgccggtaaggacctcagcaccgtcaaggtgatgatcaacggc
gccgagcgggtgcacggcgccaccgtgcggcggttcaacgagcggttcgcggcgttcggc
ctggccgactcggcgatgcgcccgtcctacggtctggcggaggcgacggtctacgtggtg
gcgtcggcgggtgggcgtccgccgaccgcggtgcggttcgattacgagaagctggccgcg
ggccacgcggaacgctgtgacgatgacggcggcgccgagctgatcggctgcggtgtgccg
cggtcgacgacggtgcgcgtggtcgatcccgacagcctggtcgagaaccccgcaggcaag
atcggcgaggtgtggctgcacggcgaccacgtggccgccggctactggcacaacccgaag
ctgagcgagctgttcgccgcgcagttgggcgagccgagcgcgggcacccccaagggtccg
tggctgcgcaccggcgacctcggcgtgatgttcgacgacgagctctacatcatcgggcgc
atcaaggacctgctgatcgtcgacgggcgcaaccactatccggacgacatcgaggccacc
gtcgccgagttcaccggcggccgggtcgcggcgatctcggtgcccgacgaggccagcgag
aagctgatcgtgatcgccgagctgaagaagcaggccgatccagccctgctggagtccgtc
aagcaacaggtgaccgcggccatctcgcagacgcacagcgtgcgactctccgacttcgtg
ctggtcgcccccggctcgctgccgctgaccaccagcggcaaggtgcgccgcgcatcctgc
gtcgagctctaccgcaacgacaagttcagccgtctggacgccactacatga

DBGET integrated database retrieval system