KEGG   Mycolicibacterium vanbaalenii: Mvan_4125Help
Entry
Mvan_4125         CDS       T00449                                 

Definition
(GenBank) fatty acid synthase, bacterial type
  KO
K11533  fatty acid synthase, bacteria type [EC:2.3.1.-]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00061  Fatty acid biosynthesis
mva01100  Metabolic pathways
mva01212  Fatty acid metabolism
Module
mva_M00082  Fatty acid biosynthesis, initiation
mva_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mvan_4125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mva01004]
    Mvan_4125
Enzymes [BR:mva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     Mvan_4125
Lipid biosynthesis proteins [BR:mva01004]
 Fatty acid synthase
  Bacteria type
   Mvan_4125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1729 Acyl_transf_1 ketoacyl-synt MaoC_dehydratas Ketoacyl-synt_C DNA_pol_B_N SAT Fas_alpha_ACP adh_short Patatin FAS_I_H
Motif
Other DBs
NCBI-ProteinID: ABM14902
UniProt: A1TCK2
LinkDB All DBs
Position
complement(4425955..4435248)
Genome map
AA seq 3097 aa AA seqDB search
MTINDQHRATTDSDGQVAQGFEPLTGTHALVDRLHSGEPYAVAFGGQGGPWLENLEELVN
SAGIESEISQLVAEAELMLEPLARELVVVRPIGFEPMKWIRALAADEPLPAAKDLTTAAI
SGPGILLTQMAAQRALKRQGLDLDGHPPVAIAGHSQGVTAVESLKAGGTRDVELLAIGQL
IGAAGSLVSRRCGMVGRGDKSPMVSVLNVDPARIAELLHDFAQDVRTVLPPALSIRNGRR
SVVITGTPEQLARFELYCEKITEKEEAERKNKVRGGAIFRPVFNQLNVEVGFHTPRLAGG
VELVNEWASRTGLDRELTRKLTEAIFIDPVDWVSEVEGLAEAGAKWIVDLGPSDTVTRLT
APVIRGLGIGIVAAATRAGQRSLFTVGAAPAVAPAWSSYAPQPIALPDGSVKASTKFTRL
TGRSPILLAGMTPTTVDAKIVAAAANAGHWAELAGGGQVTEEIFDARIKELTQLLEPGRA
IQFNSLFLDPYLWKLQVGGKRLVQKARQSGAPIDGVVVTAGIPDLEEAVELIEELHTVGI
SNVVFKPGTVDQIKSVIKIAAEVPGRDVIVHIEGGRAGGHHSWEDLDDLLLTTYGELRKY
SNVTICVGGGIGTPERAAEYLSGEWAKAYGFPDMPVDGILVGTAAMATLEATTSPAVKQL
LVETTGTETWVGAGNAINGMASGRSQLGADIHEIDNTASRCGRLLDEVAGDADAVAERRD
ELIAAMANTAKPYFGDVGDMTYLQWLQRYIELAIGDGDSTADTAAPGSPWLADTWRERFE
EMLKRAEARLNEKDSGPIESLFSDSGASSGGQALLDNPDAAIAALLARYPDAESVKLHPA
DVPFFVTLCKKPGKPVNFVPVIDKDVRRWWRSDSLWQAHDARYSADQVCIIPGTQAVAGI
TRVDEPVGELLDRFEQEIVDRVLAAGVQPVPVVSRRQARADVSGPLAVVLDSPDVLWAGR
TAINPVHRIGAPGEWQVNDVPGKPSATHPNTGARLEQATDDSGHVSVTLSVPLSDIWIDI
RFTLPAATVDGGAPIVTVEDAAKAMRSVLAIAAGVEGPESLPPVQGDTAAVTVEWDPEKV
ADHTGVTATFGAPLAPGLTLVPDALVGLCWPAVFSAIGSALTEDGFPVVEGLLSLVHLDH
AAHLLTSMPSSKSELTVTATASAATDTEVGRVVPVDVTIADSEGTVLATLSERFAIRGRT
GAAELADPPRAGGAITDNATDTPRRRRRDVVVNAPVDMSAFAVVSGDHNPIHTDRAAALL
AGLKTPIVHGMWLSAAAQHAVTATDGRATPPARLVGWTSRFLGMVLPGDEIEFRVDRVGI
DRGAEIIEVAAKVGGELVMSATAQLAAPKTVYAFPGQGIQSKGMGMDVRARSKAARAVWD
TADKFTRETLGFSVLHVVRDNPTSLIASGVHYHHPEGVLYLTQFTQVAMATVAAAQVAEM
REQGAFVEGAIACGHSVGEYTALACVSGVYELPALLEVVFHRGSKMHDIVPRDAQGRSNY
RLAAIRPSQIDLDDADVKDFVAEISDRTGEFLEIVNYNLRGSQYAIAGTVAGLEALEAEV
ERRRELSGGKRSFILVPGIDVPFHSSVLRVGVADFRRALERVMPNPNDPNLLVGRYIPNL
VPRPFTLDRDFIQEIRDLVPAEPLDEILADYDTWRNERPSELCRKIVIELLAWQFASPVR
WIETQDLLFIEEAAGGLGVERFVEIGVKNAPTVAGLAANTLKLPEYSHNTTEVLNAERDA
AVLFATDTDPEPDPEDDVADATPAAETAPAEAVPAEAAPAAPAPAAAPSGGPRPDDLAFD
AADATMALIALSAKIRIDQIEALDSIESITDGASSRRNQMLVDLGSELNLGAIDGAAEAD
LAGLKGQVTKLARTYKPFGPVLSDAINDQLRTVFGPSGKRPAYIAERVKKTWELGDGWAK
HATVEVALGTREGSSVRGGALGGLHDGALADAAAVDKAIDAAVAAIGARKGVSVSLPSAA
GGGGGVVDSAALGEFAEQVTGPDGVLASAARTILDQLGLGNQFVTPDASADAELIDLVTA
ELGSDWPRLVAPVFDGRKAVVLDDRWASAREDLARIWLMDEGDIDADWARLSERFEGAGH
VVGTQATYWQGKALAAGRTVHASLYARAAAGAENPGKGRYHDEVAVVTGASKGSIAASVV
AQLLDGGATVVATTSKLDDNRLAFYRQLYRDSARFGAKLWVLPANMASYNDIDALVEWIG
TEQSESLGPKSVHIKDALTPTLLFPFAAPRVGGDLSDAGSRSEMEMKVLLWAVQRLIGGL
SHISADRDIAARLHVVLPGSPNRGMFGGDGAYGESKAALDAVVSRWKAETSWAQRVSLAH
ALIGWTRGTGLMGHNDVIVDAVEEAGVTTYSTEQMASMLLDLCDVETKVAAAREPVLADL
TGGLAEVELDLSALATKAREEATSTSADEDGDDEAADHLIAALPSPPRPVTPAHAPEWAD
LDVDPADLVVIVGGAELGPYGSSRTRFEMEVDNELSAAGVLELAWTTGLVKWEDDPQPGW
YDTESGDLVDESELVERYHDAVVERCGIREFVDDGAIDPDHGSPLLVSVFLDKDFRFVVS
SEADARAFVQFDPEHTLARPIPDSGDWEVIRKAGTEIRVPRKTKLSRTVGAQIPTGFDPT
VWGISPDMATSVDRVALWNIVATVDAFLSSGFTPSELMRWVHPSLVASTQGTGMGGMTSM
QTMFHGNLLGRSKPNDILQEVLPNVVAAHVMQSYVGGYGAMVHPVGACATAAVSVEEGVD
KIRLGKAELVVAGGFDDMTLEAIIGFGDMAATADTEMMRAKGISDSKFSRANDRRRLGFL
EAEGGGTVLLARGDLALKMGLPVLAVVGYAQSFADGVHTSIPAPGLGALGAGRGGRDSVL
ARSLAKLGVGADDIAVISKHDTSTLANDPNETELHERLAASLGRSDGAPLFVISQKSLTG
HAKGGAAVFQMMGLCQVLRDGVIPPNRSLDCVDDELATSAHFVWPRETLRLGEKYPLKAG
LVTSLGFGHVSGLIALVHPQAFLATLTPEQRAAYTAQAQERVLAGQRRLASAIAGGRPMF
ERPADRRFDHDESEKAQEAAMLLDAASRLGEDGVYRR
NT seq 9294 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcaacgaccagcaccgtgcgacaaccgactccgacggccaggtggcccagggc
ttcgaaccactgaccggaacgcacgcactcgtcgatcggctgcactcgggcgagccgtac
gcggtggcgttcggcggtcagggaggcccgtggctggagaatctcgaggagttggtcaac
tcggccggtatcgagtcggagatcagtcagctggtcgctgaggccgaactgatgctcgag
ccgttggcgcgcgaactggtcgtcgtgcggcccatcgggttcgaaccgatgaaatggatc
cgcgcgctggccgcagacgagccgctgcccgccgccaaggacctcaccaccgcggccatc
tccggccctggcatcctgctgacccagatggccgcccagcgcgcgctcaagcgtcagggt
ctcgacctcgacgggcacccgccggttgccatcgcaggtcattctcagggcgtcacagcg
gtggaatcgctgaaggccggcggtacccgcgacgtcgagctgctcgccatcggtcagctg
atcggtgccgccggttcgctggtgtcgcgccgctgcggcatggtcggtcgcggagacaag
tcgccgatggtgtcggtgctcaacgtggatcccgcccggatcgccgagcttctccacgat
ttcgcccaggatgtgcgcacggtgctgccgcccgcgctgtccattcgcaacggcaggcgt
tcggtcgtcatcaccgggaccccggagcagctcgcccggttcgagctgtactgcgagaag
atcaccgagaaggaagaggccgagcgcaagaacaaggtccgcggcggcgcgatcttccgc
ccggtcttcaaccagctcaacgtcgaggtcgggttccacactccgcggctggccggcggc
gtcgagttggtcaacgaatgggcgtcgcgcaccgggctggaccgcgagctcacccgcaag
ctcaccgaggccatcttcatcgatcccgtcgactgggtcagtgaggtcgaagggttggcc
gaggccggcgccaagtggatcgtggacctgggcccaagcgacaccgtgacgcggttgacc
gcgccggtcatccgcggcctgggcatcggcatcgtcgcggcggccacccgcgccggtcag
cgcagcctgttcaccgtcggcgccgcacccgcggtcgcgcccgcctggtcgagctacgcg
ccccagccgatcgcgctgcccgacggttcggtcaaggcctcgaccaaattcacccgtctc
acggggcgctcgccgatcctgctcgccggcatgacgccgacgaccgtcgacgccaagatc
gtcgctgcggcggccaacgccggccactgggccgagctcgccggtggcggacaggtcacc
gaggagatcttcgacgcgcgcatcaaagagctcacccagctgctcgaaccgggccgcgcc
atccagttcaactcgctgttcctcgacccgtatctgtggaagctgcaggtgggcggcaag
cgcctggtgcagaaggcgcgccagtccggggcacccatcgacggggtggtcgtcaccgcg
ggcatcccggacctcgaagaggctgtcgagctgatcgaggaactccacaccgtcggcatc
agcaacgtggtgttcaagcccggcacggtcgaccagatcaagtcggtcatcaagatcgcc
gccgaggtgccgggtcgcgacgtcatcgtccacatcgagggcggccgcgccggcggacac
cactcgtgggaggacctcgacgatctgctgctgaccacctacggcgagctgcgcaagtac
agcaacgtcaccatctgcgtcggtggcggcatcggcaccccggagcgggccgccgagtac
ctgtccggcgagtgggcaaaagcctacggattcccggacatgccggtggacggcatcctg
gtcggcaccgccgcgatggccacgctggaggccaccacgtcacccgcggtcaagcaactg
ctcgtcgagaccacgggcaccgaaacctgggtcggggcaggcaacgccatcaacggcatg
gccagtggccgcagccagctgggcgccgacatccacgagatcgacaacaccgcctctcgg
tgcggccgcctgctcgacgaggtggccggtgacgccgacgccgtcgccgagcgacgcgac
gagctgatcgccgcgatggccaacaccgccaagccgtacttcggcgacgtgggcgacatg
acctacctgcagtggctgcagcgctacatcgagctggccatcggcgacggtgacagcacc
gccgacaccgcagcccccggcagcccgtggctggccgacacctggcgcgagcgtttcgag
gagatgctcaagcgtgccgaggcccgcctcaacgagaaggactccggcccgatcgagtcg
ctgttctcggattccggcgcgagctcgggcggtcaagcgctgctcgacaatccggatgcc
gcgatcgcggccctgctggcccgctacccggacgccgagtcggtgaagttgcatcccgcc
gacgtgccgttcttcgtgacgttgtgcaagaagcccggcaagccggtgaacttcgtgccc
gtcatcgacaaggacgtgcggcgctggtggcgcagcgactcgctgtggcaggcgcacgac
gcccgttacagcgccgaccaggtctgcatcatccccggaacccaggccgttgccggcatc
acccgtgtcgacgagcccgtcggtgagctgctcgaccggttcgagcaggagatcgtcgac
cgcgtgctggccgccggtgttcagccggtcccggtggtgtcgcgtcgccaggcccgcgcc
gacgtcagcggtccgctggccgtggtgctcgactcgcccgacgtgctgtgggccggacgc
accgcgatcaacccggtgcaccgtatcggtgcgcccggcgagtggcaggtcaacgacgtg
cccggcaagccgagcgcgacgcatcccaacaccggtgcacgcctggagcaggcgaccgac
gactccggacatgtctcggtgacgctgagcgtgccgctgtccgacatctggatcgacatc
cggttcacgctgccggccgccacggtcgacggcggtgcgccgatcgtcacggtcgaggac
gccgccaaggcgatgcgttcggtgctggccatcgccgccggtgtcgaggggccggaatcg
cttccgcccgtgcagggcgataccgcagcggtcaccgtcgagtgggacccggagaaggtc
gccgaccacaccggtgtcaccgccaccttcggcgccccgctggcgccgggcctgaccctg
gtgcccgacgctctcgtgggcctgtgctggccggcggtgttctcggcgatcggatcggcg
ctcaccgaggacggcttcccggtcgtcgagggcctgctgagcctcgtccatctggaccac
gccgcgcatctgctgacctcaatgccgtcgagcaaatccgaattgaccgtgaccgcaacg
gcttcggccgccaccgacaccgaggtcggccgcgttgtgccggtcgacgtcacgatcgcc
gactccgagggcaccgtgctggccaccctgagtgagcggttcgcgatccgcggccgcacc
ggcgcggccgaactcgccgatccgccgcgcgcgggtggggccatcaccgacaacgcgacc
gacaccccgcgccggcggcggcgcgacgtcgtcgtcaacgcaccggtggacatgagcgcg
ttcgccgtcgtctccggtgaccacaacccgatccacaccgatcgggccgctgcgttgctt
gccggtctgaaaacgcccatcgtgcacggcatgtggctgtcggccgcggcgcagcacgcg
gtcaccgcgaccgacggcagggccactccgcccgcgcgtctggtcggctggacgtcccga
ttcctcggcatggtgctgcccggtgacgagatcgagttccgggtcgaccgggtcggcatc
gaccgcggcgcggagatcatcgaggtggccgccaaggtcggcggtgagctggtgatgtcg
gcgaccgcgcagctggccgccccgaagacggtctacgccttccccggtcagggcatccag
tccaagggcatgggtatggacgtgcgggcccgctccaaggccgcccgcgccgtctgggac
accgccgacaagttcacccgtgagacgctcggcttctcggtgctgcacgtcgtgcgggac
aatccgaccagcctgatcgcctccggtgtgcactaccaccaccccgagggcgtgctgtac
ctgacgcagttcactcaggtcgcgatggccacggtcgccgcggcgcaggttgcggagatg
cgcgaacagggtgcgttcgtcgagggtgcgatcgcctgcggccattcggtcggcgagtac
accgcgctggcctgtgtgtccggcgtgtacgagctgcccgcgctgctggaggtcgtgttc
caccgcggctccaagatgcacgacatcgtgccgcgcgacgcgcagggccggtccaactac
cggctggcggccatccggccgtcgcagatcgacctggacgacgccgacgtgaaggacttc
gtcgccgagatctcggaccgcacaggtgaattcctcgagatcgtgaactacaacctgcgc
gggtcgcagtacgcgatcgccggcaccgtcgccggtctggaggcgctggaggccgaagtg
gagcggcgccgcgaactgtccggcggcaagcggtcgttcatcctggtgccgggcatcgac
gtgccgttccactcgagcgtgctgcgggtcggcgtcgccgacttccgccgggcgctggag
cgggtcatgcccaacccgaacgatcccaatctgctggtggggcgctacatcccgaacctg
gtgccgcggccgttcaccctggatcgcgacttcatccaggagatccgcgatctggtgccc
gccgagccgctcgacgagatcctcgccgactacgacacctggcgaaacgagcggccgagc
gagttgtgccgcaagatcgtcatcgagctgctggcctggcagttcgccagcccggtgcgc
tggatcgagacccaggacctgctgttcatcgaggaggccgcgggcggtctcggggtggag
cggttcgtcgagatcggcgtcaagaacgccccgacggtcgcgggcctggccgccaacacg
ctgaagctgcccgagtactcgcacaacaccaccgaggtgctcaacgccgagcgggacgcc
gcggtgctgttcgcgaccgacaccgatcccgaaccggaccccgaggacgatgtcgcggac
gccacgcctgcggcggaaaccgcaccggcagaagcggttccggccgaggcggcgcccgcc
gctccggccccggccgccgcgcccagcggtgggccgcgcccggatgatctggcgttcgac
gccgccgacgccaccatggcgctcatcgcgctttcggccaagatccgcatcgaccagatc
gaggcgctggactccatcgagtcgatcaccgacggtgcctcctcgcggcgcaaccagatg
ctggtcgacctcggctcggagctcaacctcggcgccatcgacggcgctgcagaagccgat
ctggccgggctgaagggacaggtcaccaaactggcccgcacctacaagccgttcggtccg
gtgctgtcggatgcgatcaacgatcagctgcgtacggtcttcgggccgtccggaaagcgg
cccgcctacatcgccgaacgcgtcaagaagacgtgggagctcggtgacggctgggccaag
cacgccaccgtcgaggtcgccctcggcacccgcgagggatccagtgtccgcgggggagcg
ctgggcggcctgcacgacggcgcgctggccgacgccgccgccgtcgacaaggcgatcgac
gctgcggtcgcggcgatcggcgcgcgcaagggtgtgtcggtgtcgctgccgtccgccgcg
ggtggtggtggcggtgtggtggattccgccgcgctcggcgaattcgccgagcaggtcacc
ggacccgacggtgtgctggcttcggcggcccgcacgatcctcgaccagctcggcctgggc
aaccagttcgtgacgcccgacgcgtcggccgacgcggagctgatcgacctcgtgaccgcc
gaactcggttcggactggccgcggctggtggctccggtgttcgacggacgcaaggccgtc
gtgctcgacgaccggtgggccagcgcccgtgaggatctggcgcggatctggttgatggac
gaaggggacatcgacgcggactgggcccgactgtcggaacggttcgagggcgccggccac
gtggtgggcacccaggccacctactggcagggcaaggcgctggccgcgggccgcaccgtg
cacgcctcgctgtacgcacgtgccgcggcgggtgcggagaacccgggcaagggccgctac
cacgacgaggtcgcggtggtgacgggagcgtcgaagggttcgatcgccgcttcggtggtg
gcgcagctgctcgacggcggtgccacggtggtcgccaccacgtccaagctcgatgacaac
aggttggcgttctaccgtcagctctaccgcgacagcgcgcgcttcggcgcgaagctgtgg
gtgctgccggcgaacatggcctcctacaacgacatcgacgccttggtggagtggatcggc
accgagcagagcgaaagcctcgggcccaagtccgttcacatcaaggacgccctgactccg
acgctgctgttcccgttcgcggcgccgcgggtgggcggcgacctgtccgacgcgggttcg
cgctccgagatggagatgaaggttctgctgtgggccgtgcagcggctcatcggcggcctg
tcgcacatcagcgccgaccgcgacatcgccgcccggctgcacgtggtgctgcccggttcg
ccgaaccgtggcatgttcggcggcgacggtgcctacggcgagtcgaaggcggcactcgac
gcggtcgtgtcccgctggaaggccgagacgtcgtgggcgcagcgcgtcagcctggcccac
gcgctgatcggctggacgcgcggcaccggcctgatgggccacaacgacgtcatcgtcgac
gccgtcgaagaggccggggtgaccacttactccaccgagcagatggcaagcatgctgctg
gatctctgcgatgtggagaccaaggtcgccgcggcgcgcgaacccgtgctggcggacctg
acgggtggcctggccgaggtggagctggacctgtccgcactggccaccaaggcccgcgag
gaggcgacatccacgtcggccgatgaggacggggacgacgaggccgccgatcacctgatc
gccgcgctgccgtccccgccgcgtccggtgaccccggcgcacgcgccggaatgggccgac
ctcgacgtcgacccggccgacctcgtcgtcatcgtcggcggtgccgagctgggcccgtac
gggtcgtcgcgcacccgcttcgagatggaggtcgacaacgagctgtcggcggccggtgtg
ctggagctggcgtggaccaccggtctggtcaagtgggaggacgatccccaaccaggttgg
tatgacaccgaatccggcgatctggttgacgaatccgagctcgtcgagcgctaccacgac
gccgtggtggagcgatgcggcatccgggagttcgtcgatgacggcgcgatcgatcccgat
cacggctcgccgctgctggtgagtgtgttcctggacaaggacttccggttcgtggtctcc
agtgaggccgacgcgcgggcgttcgtccagttcgatcccgagcacacccttgcccgcccg
atcccggattccggcgactgggaggtgatccgcaaggcgggcaccgagatccgcgtgccg
cgcaagaccaagctgtcgcggaccgtgggtgcgcagatccctacaggcttcgacccgacc
gtgtggggcatcagcccagacatggcgacgtcggtcgaccgggtcgcgctgtggaacatc
gtggccacggtggacgcgttcctgtcatcgggcttcaccccgtcggagctgatgcgctgg
gtgcacccgagcctggtggcctccacgcagggcaccggcatgggtggcatgacgtcgatg
cagacgatgttccacggcaacctgctcggacgtagcaagccgaacgacatcctgcaggag
gtgctgcccaacgtcgttgcggcccatgtgatgcagtcctacgtgggcggctacggcgcg
atggttcacccggtcggcgcatgcgccaccgccgcggtctcggtcgaggagggggtggac
aagatccgcctcggcaaggccgaactggtggtcgcgggcggcttcgacgacatgacgctg
gaagccatcatcggcttcggggacatggcggccaccgccgacaccgagatgatgcgggcg
aagggaatcagcgattcgaagttctcccgcgccaacgaccggcgcaggctgggcttcctg
gaggccgagggtggtggcaccgtgctgctggcccgtggcgacctggcgctgaagatgggg
ctgccggtgctggcggtcgtcgggtacgcgcagtcgttcgccgacggtgtgcacacctcg
atcccggcccccgggctgggcgcactcggtgcaggccgtggcggcagggactcggtgctg
gcgcggtcgctggccaagctgggggtgggcgcggacgacatcgcggtgatctccaagcac
gacacctcgacgctggccaacgatcccaacgagaccgaactgcatgagcggctcgcggcc
tcgctgggtcgttcggacggcgcgcccctgttcgtcatcagccagaagagcctgaccggg
cacgccaagggcggcgcggcggtcttccagatgatgggtctgtgccaggtgctgcgcgac
ggtgtcatcccgccgaaccgcagcctggactgtgtcgacgacgagctggcgacctcggcg
cacttcgtgtggccacgggagacgctgcgactgggtgagaagtacccgctgaaggcgggg
ctggtcaccagcctcgggttcggtcacgtgtccggtctgatcgcgctggtgcacccgcag
gcgttcctggccacgctgacccccgagcagcgggcggcctacaccgcccaggctcaggag
cgggtcctggccggacagcgcaggctggcctcggcgatcgcgggcgggcggccgatgttc
gagcggccggccgaccgccgcttcgaccacgacgagtcggagaaggcgcaggaagccgcg
atgctgctcgacgcggcatcacggctcggcgaggacggcgtgtatcggcgttga

DBGET integrated database retrieval system