KEGG   Mycolicibacterium vanbaalenii: Mvan_4309Help
Entry
Mvan_4309         CDS       T00449                                 

Definition
(GenBank) putative adenylate/guanylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00230  Purine metabolism
mva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mvan_4309
Enzymes [BR:mva01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Mvan_4309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc HAMP RuvX
Motif
Other DBs
NCBI-ProteinID: ABM15086
UniProt: A1TD36
LinkDB All DBs
Position
4617640..4619250
Genome map
AA seq 536 aa AA seqDB search
MNATKSVPYRLGRVLERVTRQSGRLETPDYGSWLLGKPEESQARRRIRIQVILTFLLLFT
NILGIAVSLLLNTVAIPVPSVFSDAPAWLTFGVVPAYMVVALVLGTAWITSRTVGSLRWA
IEERSPTRTDQRNVFVAPSRVAQMLLLFWGFGAALLTLLYGLQDSAFIPRFLFAVGFPGI
VVATACYMITEFALRPVAAQALEAGRPPRRLAHGVMGRTMTVWLLSSGVPVLGILLLAIF
TLSLRNLSATQFAVAVMIISVVALMFGLILMWLLSWLIATPVRVVRSALKHVEDGDLDCN
VVVFDGTELGELQRGFNSMVHGLRERERVRDLFGRHVGREVARAAEKQKIELGGEERHAA
VIFVDIIGSTQLVTSRPAVEVVELLNRFFDVVVEEVDNHHGLVNKFEGDAVLAVFGAPVS
LDSAETEALSAARAMARRLRTEVPECPAGIGVAAGQVVAGNVGAKQRFEYTVIGEPVNEA
ARLCELAKNVPALLVASADAVGGATESERALWKLGETVTLRGHDQPTRLATPAGEL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgacgaagagcgtgccgtatcggttgggccgggttctggagagggtgacccgg
cagagcgggcggctggaaacgccggactacggctcctggctgttgggcaagccggaagag
agccaggcccgccgacgcatacgcatccaggtcatcctgacgttcctcctcctgttcacc
aacatcctgggcatcgcggtgtcgctgttgctcaacacggtcgccatcccggtgcccagc
gtcttctccgacgccccggcatggctgaccttcggcgtcgtgcccgcctacatggtggtc
gcgctggtcctcggcacggcctggatcacgtcgcggaccgtcggctcgctgcgctgggcg
atcgaggagcgcagcccgacccgcaccgaccagcgcaacgtgttcgtcgccccgtcccgg
gtcgcgcagatgctgttgctgttctggggtttcggtgcggcgctgctgacgttgctgtac
ggactgcaggactcggcgttcatcccccgattcctgttcgccgtgggtttccccggcatt
gtcgtcgccaccgcgtgctacatgatcaccgagttcgccttgcgcccggtcgccgcccag
gcgctggaggcgggtcgcccaccgcgccggctggcgcacggtgtcatggggcggaccatg
accgtatggctgctgagctccggggtgcccgtgctcggcatcctgctgctcgcgattttc
acgctgtccctgcggaatctgagcgcgacgcagttcgccgtggccgtgatgatcatctcc
gtcgtcgcgctgatgttcgggttgatcctgatgtggctgctgtcatggctcatcgccacc
cctgtccgcgtcgtgcgctcggcgctcaaacacgtcgaggacggcgacctggactgcaat
gtggtggtgttcgacggcaccgaactcggtgagctgcaacgcgggttcaactcgatggtg
cacggactgcgtgaacgcgaacgggtgcgtgatctgttcggacggcacgtcggtcgcgaa
gtcgcgcgggccgccgagaagcagaagatcgagctgggcggggaggaacgccatgcggcc
gtcatcttcgtcgacatcatcggttccacccagctcgtcacgagcaggccggccgtcgag
gtcgtcgagttgctcaaccggttcttcgacgtcgtcgtcgaggaggtcgacaaccaccac
ggcctggtgaacaagttcgagggggacgcggtgctggcggtgttcggcgcacccgtctca
ctcgacagcgccgagaccgaagcgctctccgcggccagggccatggcgcggcggctacgc
accgaggtcccggagtgcccggcaggcatcggcgtggccgccggtcaggtggtggcgggc
aacgtgggcgccaagcaacgcttcgagtacaccgtcatcggcgagccggtcaacgaggcc
gccaggctgtgcgaactcgccaagaacgtgcctgcgctgctggtcgcctcggccgacgcg
gtcggcggcgcgaccgagtccgaacgtgcgctctggaagctgggcgagaccgtgacgctg
cgcggccacgatcagccgacgcggctggctacaccggccggcgagctttag

DBGET integrated database retrieval system