KEGG   Mycolicibacterium vanbaalenii: Mvan_5549Help
Entry
Mvan_5549         CDS       T00449                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mva  Mycolicibacterium vanbaalenii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABM16315
UniProt: A1TGL5
LinkDB All DBs
Position
5929804..5930886
Genome map
AA seq 360 aa AA seqDB search
MQLPVMPPVSPMLSKSVDTIPDGASYEPKWDGFRSILFRDGNEVELGSRNERPMTRYFPE
LVEAARAELPPRCVVDGEIVVATGGGLDFEALQLRLHPAASRVRMLAEKTPASFIAFDLL
ALDDTDYTARPFAERRAALVGALAGCGPTFHVTPATLDVATARRWFDEFEGAGLDGVIAK
PLDGHYLPDKRVMFKIKHQRTADCVVAGYRLHKSGPDAVGSLLLGLYDDDGSLASVGVVG
AFPMARRRELVTELQPLVTTFDGHPWNWAAQVDPDTVRRYGGGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGQRFRHTAQFNRWRPDRDPLSCTFDQLDRPLTFSLDDIVPGLGGTRPRG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttcccgtgatgcccccggtctcgccgatgctgtcgaagtcggtcgacaccatc
cccgacggcgcctcctacgagcccaagtgggacggattccggtcgattctgttccgggac
ggcaacgaggtggagctcggcagccgcaatgagcggccgatgacgcggtattttcccgag
ctcgtcgaggcggcccgcgccgagttgccgccccgctgcgtcgtcgacggagagatcgtc
gtcgccaccggcggcggcctcgacttcgaggcgctgcaactgcggctgcacccggccgca
tcgcgggtgcggatgctggccgagaagacgccggcgtcgttcatcgcattcgacctgctc
gcgctcgacgacaccgactacaccgcgcggccgttcgccgagcggcgggcggcgctggtc
ggggcgctcgccgggtgcggccccacgttccacgtcacaccggccaccctggacgtcgcg
acggcgcgacggtggttcgacgagttcgaaggcgccgggctcgacggagtgatcgccaag
ccgctcgacgggcactacctgccggacaagcgggtgatgttcaagatcaagcaccagcgc
accgcggactgtgtggtggccggctaccgcctgcacaagtcgggccccgatgcggtgggt
tcactgctgctggggctctacgacgacgacggttcgctggcgtcggtgggcgtcgtcggc
gcgttcccgatggcgcggcgtcgtgagctcgtcaccgaattgcagccgctggtgaccacg
ttcgacgggcacccgtggaactgggccgcgcaggtcgacccggacacggtgcgccgctac
gggggcggctcgcggtggaacgccggcaaggacctttcgttcgtcccactgcgtcccgaa
cgcgtcgtcgaggtgcgctatgaccacatggaggggcaaaggttccggcacacagcgcaa
ttcaaccgctggcgacccgaccgcgacccgctttcctgcacgttcgaccaactcgaccgc
ccactgacgttcagcctcgacgacatcgtgccgggccttggcggtacccggccccggggc
taa

DBGET integrated database retrieval system