KEGG   Methanosarcina vacuolata: MSVAZ_2500Help
Entry
MSVAZ_2500        CDS       T03815                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mvc  Methanosarcina vacuolata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: AKB44769
UniProt: A0A0E3Q788
LinkDB All DBs
Position
complement(3214201..3214656)
Genome map
AA seq 151 aa AA seqDB search
MLEEYEKKRHFQKTPEPLTSDFKQISDKPIFVVQRHDARKLHYDFRLEMDGVLKSWAMPK
EPPKEAGIRRLAIETEDHPLAYADFEGEIPAGEYGAGKVEIWDKGTFELLKREEKEIVVA
LEGEELKGIYVLIRTKYGKGEKGWLFFKKAS
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagaatatgagaagaaaagacactttcaaaagactcctgaaccgctgaccagt
gattttaaacaaatctccgacaaaccgatttttgtggttcagcgccatgatgcgcgtaag
cttcactatgattttcgcctggaaatggatggagttttgaaaagctgggctatgccaaag
gagcccccgaaggaggcaggcatcagacggcttgctatcgagactgaagaccatccgctg
gcatatgccgattttgagggagaaatcccggcaggggagtacggagccggcaaggttgag
atatgggataagggaacttttgagcttttgaaacgtgaggaaaaggaaattgtagtggca
cttgaaggagaagaattgaaagggatttatgttttaatacggacaaagtacggaaaaggc
gaaaagggctggctcttctttaaaaaggccagctaa

DBGET integrated database retrieval system