KEGG   Microterricola viridarii: AWU67_01300Help
Entry
AWU67_01300       CDS       T04252                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mvd  Microterricola viridarii
Pathway
mvd00564  Glycerophospholipid metabolism
mvd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AWU67_01300
Enzymes [BR:mvd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AWU67_01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Fn3-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMB60265
UniProt: A0A0Y0NKC8
LinkDB All DBs
Position
281453..283189
Genome map
AA seq 578 aa AA seqDB search
MAQRNSVTRSSKLGPEERAAALARLKDKELDILVVGGGIVGAGSALDAVTRGLSVGILEE
RDWASGTSSRSSKLVHGGIRYLEQLDFRLVREALIERGLLLQRIAPHLVKPVRFLYPLKK
RVIERAYVGAGMLLYDIFSYTGGRPPGVPHHRHLSKRQVERLIPSLSHDALVGGITYYDA
QVDDARYVSSLVRTASFYGAHAASRVRVEGFIKVGQRVVGVQAHDLQTGEKFEVRAKQVV
NATGVWTDDTQRMVGERGTFKVRASKGIHLVVPRDRFQSAMGLLLRTEKSVLFVIPWGRH
WLIGTTDTDWNLDKAHPAATAADIDYLLEHVNKVLSIQLTREDVEGVYAGLRPLLAGESE
QTSKLSREHLVAHTVPGLVVIAGGKWTTYRVMAKDAIDAAVDALDGRIPPSTTQDIPLLG
AEGYQAAWNKRGRIAQAFGVHKVRIEHLLNRYGTLTDELLDLIKSDPSLGEPLPGADDYL
GAEVVYAASHEGALHLEDVLARRTRISIEAWDRGVSAAPVAAKLMAGVLGWDEELEQLEV
ANYLKRVAAERASQEQPDDASADHVRLEAPDIMAVEGK
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgcaacagcgtgacgcgttcgagcaagctcggaccggaggagagggcggcc
gccctcgcccggctcaaagacaaagagctggacatcctggtggtcgggggtggcatcgtc
ggggccgggtcggcgctggacgccgtcacccgaggcctcagcgtcgggatcttggaggag
cgcgactgggcgtcgggaacgtccagccgctcctcgaagctggtgcacggcggcatccgg
tacctcgagcaacttgacttccggttggtgcgggaggcgctgatcgagcgcgggctgctg
ctgcagcgtattgccccgcatctggtgaagccggtgcgcttcctctacccgctgaagaag
cgggtgattgagcgtgcctatgttggcgccggcatgctgctctacgacatcttcagctac
acgggcggccgcccgcccggggtgccgcaccaccgccacctgagcaagcggcaggtggag
cggctcatcccgtctctctcgcacgacgccctggtcggcggcatcacctactacgacgct
caggtcgacgacgcgcgctacgtgtcgtcgctggtgcgcaccgcctccttctacggcgcg
cacgcggcctcccgggtgcgggtcgagggctttatcaaggtcggccagcgggtggtcggc
gtgcaggcgcacgacctgcagaccggcgagaagttcgaggtgcgcgccaagcaggtcgtc
aacgcgaccggcgtgtggacggatgacacccagcgcatggtgggggagcggggcactttc
aaggtgcgggcctccaagggcatccacctcgtggttccgcgcgaccgcttccaatcggcg
atgggcctgctgctgcgcaccgagaagagcgtgctgttcgtgatcccgtggggcaggcac
tggctgatcggcaccaccgacacggactggaacctggacaaggcgcacccggccgcgacc
gcggccgacatcgactacctgctcgagcacgtcaacaaggtgctgtcgatccagctcacc
cgggaggacgtcgagggcgtctacgccggtctgcggccgctgctggccggcgagagcgag
cagacctccaagctctcccgtgagcaccttgtcgcgcacaccgtgccggggctcgtcgtg
attgccggcggcaagtggaccacgtaccgggtgatggccaaggacgccatcgacgctgcg
gtcgacgcgctggatggccgcatcccaccgtcgacgacgcaggacatcccgttgctcggc
gcagagggctaccaggcggcgtggaacaagcgcggccgcatcgcgcaagccttcggcgtg
cacaaggtgcgcatcgagcacctgctcaaccgttacggcacgctgacagatgagctgctc
gacctgatcaagtcggatccctccctcggcgagcccctgccgggggccgacgactacctc
ggtgccgaggtcgtctacgcggcctcgcacgagggggcgctgcacctggaggacgtgctc
gcccgccgcacccggatctcgatcgaggcctgggaccgcggcgtctcggccgcgcccgtc
gctgcgaagctgatggccggcgtgctcggttgggatgaggaactcgaacagctcgaggtg
gcgaactacctgaagcgggtggcggccgaacgggcctcgcaggagcaaccagacgacgcg
tccgccgaccacgtgcgcctggaagccccggacatcatggcggtcgaggggaagtag

DBGET integrated database retrieval system