KEGG   Microterricola viridarii: AWU67_03735Help
Entry
AWU67_03735       CDS       T04252                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mvd  Microterricola viridarii
Pathway
mvd00010  Glycolysis / Gluconeogenesis
mvd00030  Pentose phosphate pathway
mvd00051  Fructose and mannose metabolism
mvd00052  Galactose metabolism
mvd00680  Methane metabolism
mvd01100  Metabolic pathways
mvd01110  Biosynthesis of secondary metabolites
mvd01120  Microbial metabolism in diverse environments
mvd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mvd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWU67_03735
   00030 Pentose phosphate pathway
    AWU67_03735
   00051 Fructose and mannose metabolism
    AWU67_03735
   00052 Galactose metabolism
    AWU67_03735
  09102 Energy metabolism
   00680 Methane metabolism
    AWU67_03735
Enzymes [BR:mvd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AWU67_03735
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AWU67_03735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AMB58120
UniProt: A0A0Y0MI79
LinkDB All DBs
Position
836769..837800
Genome map
AA seq 343 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGVISHDTEFVGFKSGWRGVVEADIMPITRHDVRGL
AKQGGTILGSSRTNPFEGEGGGPENIQRMLDENGIDAIIAIGGEGTLTAARRLHDEGGIN
VVGVPKTIDNDLTATDYSFGFDTAVEIATEAIDRLRTTADSHGRCMVLEVMGRHVGWIAL
HSGMAGGAHAILIPEQPQSIEQICEWVESVRERGRAPLVVVAEGFTLEGMSEAHSHKGLD
AFNRPRLGGIADLLAPMIEERTGIESRGTVLGHIQRGGAPSAYDRVLATRLGMAAVEAVY
NKQWGSMVSLRGTEIKTVSIAEATGGLNTVPQERFDEARILFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggaatcttgacgagtggcggcgactgccccggactgaacgcggtgatccgc
ggagcggtgctgaagggcgtcatctcacacgacaccgagtttgtgggcttcaagtcgggc
tggcgcggcgtcgtcgaggccgacatcatgccgatcacgcgccacgatgtgcgcggcctc
gccaagcagggtggcaccatcctcggctccagccgcaccaaccccttcgagggtgagggc
ggtgggccggagaacatccagcgcatgctggatgagaacggcatcgacgcgatcatcgcg
atcggcggcgagggcaccctcaccgccgcccgccgcctgcacgacgagggcggcatcaac
gtcgtcggcgtgccgaagacgatcgacaacgacctgaccgccaccgactactccttcggc
ttcgacaccgcagtggagatcgccacggaggccatcgaccgcctgcgcaccaccgccgac
tcgcacggccgctgcatggtgctcgaggtcatgggccgccacgtgggctggatcgccctg
cactccggcatggccggcggcgcacacgccatcctgatccccgagcagccgcagtcgatc
gagcagatctgcgagtgggtcgagtccgtgcgcgagcgtggccgcgcccccctcgtcgtc
gtcgcagagggcttcaccctcgagggcatgagcgaggcacactcgcacaagggcctggac
gccttcaatcggccgcggctcggcgggatcgcagacctgctggcgccgatgatcgaggag
cgcaccggcattgagtcccgcggcaccgtgctcggccacatccagcgcggcggcgccccg
agcgcctacgaccgcgttctggccacccggctcggcatggcggccgtcgaggccgtctac
aacaagcagtggggctccatggtgtcgctgcgcggcaccgagatcaagaccgtgagcatc
gcagaggccaccggcgggttgaacaccgtgccgcaggagcgcttcgacgaggcccgcatc
ctgttcggctga

DBGET integrated database retrieval system