KEGG   Microterricola viridarii: AWU67_07440Help
Entry
AWU67_07440       CDS       T04252                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mvd  Microterricola viridarii
Brite
KEGG Orthology (KO) [BR:mvd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mvd01001]
    AWU67_07440
Enzymes [BR:mvd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AWU67_07440
Protein kinases [BR:mvd01001]
 Serine/threonine kinases: Other
  Bacterial family
   AWU67_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal Haspin_kinase FTA2 RIO1
Motif
Other DBs
NCBI-ProteinID: AMB58719
UniProt: A0A0X8E1M8
LinkDB All DBs
Position
1612711..1614678
Genome map
AA seq 655 aa AA seqDB search
MSSTPNDPMIGRLIDGRYQVRSRIARGGMATVYLATDLRLERRVAIKIMHGHLADDDTFK
TRFVQEARSAARLAHPNVVNVFDQGQDSDMAYMVMEYLPGITLRDLLKDYGKLTPEQTID
IVTAVLGGLAAAHKAGIVHRDLKPENVLLADDGRIKLGDFGLARAASANTATGQALLGTI
AYLSPELVTRGVADARSDIYALGIMMYEMLTGEQPFVGEAPMQIAYQHANDSVPAPSLKV
PSLPHELDELVLWASARDPEDRPRDAGAMLEQLLVVTAGMQGTAEPGATEATTVMPGPLA
PTMVLSGAALAGVDDFAGSDSETQIIGSARHRTGPVDAADADGAAQLRGKAASRKRRGYW
LFAAIVLLTGLAVGTGWYFGSGPGSRATVPDVTGQSVDSAVTDITAAGLQAAETTASCSH
PSIAPELVASTKPAVGSSLPRGALVTICVSTGPAIIDVPAVIGLPEAEARTTLGPLFAVA
EASDVRFTDEQPAGAVIALLDADGNAVAATAYEQSPVTLVVSAGPVPDVAGKSVDDATNT
LKAAGLEVETTDPVFNSTVPDGVVISASPQADGPVRAGSTIVLSVSKGPDLVEVPDVVGM
NLGEAIQKLRDEGFVVSYSFPDLLIPVANAVSTDPAAGELVERGSAITVKGQVTL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccacaccgaatgatccgatgatcggccgtctgatagacggccgttatcaggtg
cgctcccgcatcgcccgtggcggcatggcgaccgtctacctcgccaccgacctgcgcctg
gagcgccgcgtcgcgatcaagatcatgcacggccacctggccgacgacgacacgttcaag
acccggttcgtgcaggaggcccgctccgccgcgcgcctcgcccacccgaacgttgtcaac
gtgttcgaccagggccaggactccgacatggcctacatggtcatggagtacctgccgggc
atcacgctgcgcgatctgctcaaggattacggcaagctcacccccgagcagaccatcgac
atcgtcaccgcggtactgggcggcctggccgccgctcacaaggctggcatcgtgcaccgc
gacctgaagccagagaacgtgcttctggccgacgacggccgcatcaagctcggtgacttc
ggcctggcgcgcgccgccagcgccaacaccgcgaccgggcaggcactgctcggcacgatc
gcctacctctcccccgagctcgtcactcgtggcgtcgcagacgcccgcagcgacatctac
gcactcggcatcatgatgtacgagatgctcaccggcgagcagcccttcgtcggcgaggcg
ccgatgcagatcgcttaccagcacgccaacgactccgtgcccgcaccgagcctcaaggtg
ccgagccttccccacgagctcgacgagctggtgctctgggcctctgcgcgcgatccggag
gaccgcccacgggatgccggcgccatgctcgagcaactgctcgtggtcaccgctggcatg
cagggcacagccgagccgggcgcgacagaggccaccacggtgatgcccggccccctcgcg
ccgaccatggtgctctccggcgctgcactggccggcgtcgacgacttcgccggctccgac
tcggagacccagatcatcgggagcgcccggcaccgcacaggacctgtcgacgccgccgac
gccgacggcgccgcgcagctgcgcggcaaggccgcatcgcgtaagcgccgcggctattgg
ctgttcgcggccatcgtgctgctgaccggcctcgccgtcggaactggctggtacttcggc
tccggcccgggctcccgcgccaccgtgcccgacgtcaccggccagagcgtcgacagtgcc
gtcaccgacatcactgccgccgggctccaggcagccgagaccaccgcgagttgctcccac
ccgagcatcgcgccggagctggttgccagcacgaagccggccgtgggcagctccctgccc
cgcggcgccctcgtcacaatctgcgtctccaccggcccggccatcattgacgtgcccgcc
gtgatcggcctgccggaggccgaggcccgcaccacgctcgggccgctgttcgccgtcgcc
gaggccagcgacgtccgcttcacggatgagcagccggccggcgccgtcatcgccctgttg
gacgcggacggcaacgccgtggccgccaccgcctacgagcagtcccccgtgacgctcgtc
gtctcggccggcccggtgcccgacgtcgcagggaagagcgtcgacgacgcgacgaacaca
ctgaaggcggcggggctcgaggtcgagacgaccgaccccgtcttcaattccaccgtgcca
gacggcgttgtgatctccgcatcgccgcaggccgatggccccgtgcgggccggatcgacg
atcgtgctctcggtgtcgaagggccccgacctagtcgaggtgcccgacgtcgtcggaatg
aacctcggcgaggcgatccagaagctgcgcgacgagggcttcgtggtcagctacagcttc
cccgacctgctcatccccgtcgcgaacgcggtgtcgacagaccccgccgccggcgagctc
gtcgagcgtggctcagccatcacggtcaagggacaggtcacgctctag

DBGET integrated database retrieval system