KEGG   Microterricola viridarii: AWU67_08355Help
Entry
AWU67_08355       CDS       T04252                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mvd  Microterricola viridarii
Pathway
mvd00020  Citrate cycle (TCA cycle)
mvd00480  Glutathione metabolism
mvd01100  Metabolic pathways
mvd01110  Biosynthesis of secondary metabolites
mvd01120  Microbial metabolism in diverse environments
mvd01130  Biosynthesis of antibiotics
mvd01200  Carbon metabolism
mvd01210  2-Oxocarboxylic acid metabolism
mvd01230  Biosynthesis of amino acids
Module
mvd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mvd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWU67_08355
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWU67_08355
Enzymes [BR:mvd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AWU67_08355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AMB58878
UniProt: A0A120I150
LinkDB All DBs
Position
1803504..1805714
Genome map
AA seq 736 aa AA seqDB search
MTKIVYTYTDEAPMLATHSFFPVISAFAGTAGVELETRDISLAGRILAAFPEKLSAEQQV
GDALAELGALATTPEANIIKLPNISASLPQLKAAISELQAKGYDIPDHPDAPATDADKDV
RARYDKIKGSAVNPVLREGNSDRRAPLSVKEYVRKNPHRMGAWAADSKTNVATMGHDDFF
SNEKSVVIADDDVLRIEHVNAAGEVTTLHPGVKVLPGEVIDATFLNVAKLHEFLAEAIER
ARAEDVLFSVHLKATMMKVSDPIIFGHVVRAFFPAVFEQYGAELQAAGLTPNNGLGSILD
GLDALENGAEIRAAFEQGLKDGPRLAMVNSDKGITNLHVPSDVIVDASMPAMIRSSGHMW
GVDGAEHDTIAVIPDSSYAGIYQAVIDDCRANGAYDPTTMGTVPNVGLMAQKAEEYGSHD
KTFELSEAGTVRVVNQAGEALLEHAVQAGDIWRACQTKDVAIRDWVKLAVNRARATGTPT
VFWLDENRAHDANLIAKVNAYLPEHDTAGLDIRVLAPAAATTLSVERIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSIVPLLNGGGLFETGAGGSAPKHVQQLVEENYLRWDSL
GEFLALAASFEHFADANDNAKARVLGATLDRATGTFLLENKSPGRALGTIDNRGSHFFLT
LFWAEELAKQTEDAELAAAFAPLAATLRANEQTIVDELIAVQGSPVDIGGYFKVDEAKTD
AVMRPSTTFAEALASL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagatcgtctacacctacaccgatgaggcgccgatgctggcgacacactcgttc
ttccccgtcatcagcgccttcgccggcaccgcgggtgtcgagctcgaaacgcgtgacatc
tccctcgccggccgcatcctggccgcgttccccgagaagctgagcgccgagcagcaggtc
ggcgatgcactcgccgagctgggcgcgctcgccaccacgcccgaggcgaacatcatcaag
ctgccgaacatctcggcgtcgctgccgcagctgaaggccgcaatctcggagctgcaggcc
aagggctacgacattccggatcaccccgacgcccccgcgacggatgccgacaaggacgtg
cgcgcgcgctacgacaagatcaagggatccgcggtgaacccggtgcttcgtgagggcaac
tccgaccgtcgcgcgccgctctcggtcaaggagtacgtgcgcaagaacccgcaccgcatg
ggggcgtgggcagccgactccaagaccaacgtcgccaccatgggacacgacgacttcttc
tccaacgagaagtcggttgtcatcgccgacgacgacgtgctgcgcatcgagcacgtgaac
gcggccggcgaagtcaccaccctgcaccccggcgtgaaggtgctgccgggtgaggtcatc
gacgccacattcctcaacgtcgccaagctgcacgagttcctcgccgaggcgatcgagcgc
gcccgcgccgaagacgtgctgttctccgtgcacctcaaggccaccatgatgaaggtctcc
gacccgatcatcttcggtcacgtcgtccgcgccttcttcccggccgtgttcgagcagtac
ggcgcagagctccaggccgcgggactcacccccaacaacggcctcggcagcatcctcgac
gggctggatgccctcgagaacggcgccgagatccgcgccgcgttcgagcaggggctgaag
gacggcccgcgcctggccatggtcaactccgacaagggcatcaccaacctgcacgtgccg
agcgacgtgatcgtcgacgcctcgatgccggccatgatccgcagctccgggcacatgtgg
ggcgtcgacggcgccgagcacgacaccatcgccgtcatccccgactccagctacgccggc
atctaccaggccgtgatcgacgactgccgcgccaacggcgcgtacgacccgaccaccatg
ggcaccgtgccgaacgtcggcctcatggcacagaaggccgaggagtacggctcgcacgac
aagacgttcgagctcagcgaggcgggcaccgtgcgcgtcgtcaaccaggcaggcgaggcc
ctgctggagcacgccgtgcaggccggtgacatctggcgcgcctgccagaccaaggatgtc
gccatccgcgactgggtgaagctcgccgtcaaccgcgcccgcgcgaccggcacgcccacc
gtgttctggctcgacgagaaccgcgcccacgacgccaacctcatcgccaaggtcaacgcc
tacctgcccgagcacgacacggccggcctcgacattcgggtgctcgcacccgccgcggcc
accacgctctcggtcgagcgcatccgtcgcggcgaggacaccatctcggtgaccggcaac
gtgctgcgcgactacaacaccgacctgttcccgattctggagctcggcaccagcgccaag
atgctctcaatcgtgccgctgctcaacggcggcggtctcttcgagaccggcgcgggcgga
tcggccccgaagcacgtgcagcagctcgtggaggagaactacctgcgctgggacagcctg
ggtgagttcctcgcgctggccgccagcttcgagcacttcgccgacgccaacgacaacgcc
aaggcccgtgtgctcggtgcgaccctcgaccgcgccaccggcaccttcctgctcgagaac
aagtcgcccggccgtgccctcggcacgatcgacaaccgcggctcgcacttcttcctcacc
ctgttctgggccgaggagctggccaagcagacagaggacgccgagctggccgccgcgttc
gcgcccctggccgcgacgctccgtgccaacgagcagaccatcgtcgacgagctgatcgcc
gtgcagggatcgcccgtcgacatcggcggctacttcaaggtcgacgaggccaagaccgac
gcggtcatgcgcccgtcgacgaccttcgccgaggcgctcgcctcgctgtaa

DBGET integrated database retrieval system