KEGG   Microterricola viridarii: AWU67_12530Help
Entry
AWU67_12530       CDS       T04252                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K10548  putative multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
mvd  Microterricola viridarii
Pathway
mvd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mvd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AWU67_12530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mvd02000]
    AWU67_12530
Transporters [BR:mvd02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter
    AWU67_12530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_23 AAA_29 AAA_22 RsgA_GTPase ABC_ATPase AAA_16 Rad17 DUF2963 AAA_30 MMR_HSR1 Herpes_BBRF1
Motif
Other DBs
NCBI-ProteinID: AMB59554
UniProt: A0A120I170
LinkDB All DBs
Position
complement(2732461..2733990)
Genome map
AA seq 509 aa AA seqDB search
MTTNILEMRGITKTFPGVKALSNVTLSAERGEVLAICGENGAGKSTLMKVLSGVYPHGSY
TGDIVFEDEIVEFKDITDSEAKGIVIIHQELALSPYLSIAENIFLNNELKNPFGLIDWNK
TNHEAQKLLARVGLSDNPTTRIMDIGVGKQQLVEIAKALSKRVKLLILDEPTAALNDEDS
AHLLNLILHLKGQGITSIIISHKLNEIKKIADSVTVIRDGKTIETIAKTDVTEERIIKDM
VGRDLESRYPDHTPNIGEELLRVEDWTAHHPQDQNRVVVDNVNITVHAGEIVGIAGLMGA
GRTEFAMSLFGRSYGTKISGRVFKRGKEIKTRTVSEAIGNGIAYATEDRKTYGLNLIEDI
KRNISMASLGKLEKWGLVHDNEEYRVANEFRTSMNIKAPSVLAKTGKLSGGNQQKVVLSK
WIYSDPDVLILDEPTRGIDVGAKYEIYAIINKLAAEGKGIIVISSELPELLGISDRVYAI
SEGRITGEMPIAEATPESVLKLMTMEKPR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaacattctggagatgcgcggcatcaccaagacgttccccggtgtcaaagca
ctctccaacgtcacgctctcggccgaacgcggcgaggtgctcgcgatctgcggtgagaac
ggcgcgggcaagtccaccctcatgaaggtgctgagtggcgtctacccgcacggcagttac
accggcgacatcgtgttcgaagacgagatcgtcgagttcaaggacatcaccgatagcgag
gccaagggcatcgtcatcatccaccaggagcttgcgctcagcccgtacctctctattgca
gagaacatcttcctcaacaacgagttgaagaaccccttcgggctgatcgactggaacaag
accaaccacgaggcgcagaagctgctcgcccgggtcggcctgagcgacaacccgaccacc
cgcatcatggacatcggcgtcggcaagcagcagctggtcgagatcgccaaggcactctcc
aagcgcgtcaagctgctcatcctggacgagccgacggccgccctcaacgacgaggactcg
gcccacctgctcaacctgatcctgcacctcaaggggcagggcatcacgtcgatcatcatc
agccacaagctgaacgagatcaagaagatcgccgactctgtcaccgtcatccgtgacggc
aagacgatcgagacgatcgcgaagacggatgtcaccgaagagcgcatcatcaaagacatg
gtcggccgcgacctcgagagccgctaccccgaccacacgccgaacatcggcgaggagctg
ttgcgcgtcgaggactggacggcgcaccacccgcaggaccagaaccgcgtcgtcgtcgac
aatgtgaacatcaccgtgcacgccggcgagatcgtcggcatcgccgggctgatgggcgcc
ggccgcaccgagttcgcgatgagcctgttcgggcgcagctacggcaccaagatctctggc
cgcgtgttcaagcgcggcaaggagatcaagacgcgcaccgtctcggaggcgatcggcaac
ggcatcgcctacgcgaccgaggaccgcaagacctacggtctcaacctcatcgaggacatc
aagcgcaacatctcgatggcctccctcggcaagctcgagaagtgggggctcgtgcacgac
aacgaggagtaccgcgtcgcgaacgagttccgcacgagcatgaacatcaaggcgccgtcg
gtgctggccaagaccggcaagctctccggtggaaaccagcagaaggtcgttctgtcgaag
tggatctactccgacccggacgtgctgatcctcgatgagcccacccgcggcatcgacgtc
ggtgccaagtacgagatctacgcgatcatcaacaagctggcggcggagggcaagggcatc
atcgtgatctcctccgagctgccggaactgctcggcatctccgaccgcgtctacgcgatc
tccgagggccgcatcacgggcgagatgcccatcgcggaggccacaccggaatccgtcctc
aaactcatgaccatggaaaagccccgctag

DBGET integrated database retrieval system